[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ftsA
DDBJ      :ftsA         cell division protein FtsA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:369 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   87->246 1e4fT PDBj 1e-06 20.9 %
:RPS:PDB   4->307 1e4gT PDBj 5e-07 16.6 %
:RPS:SCOP  195->307 1e4fT2  c.55.1.1 * 4e-07 25.7 %
:HMM:SCOP  4->186 1e4fT1 c.55.1.1 * 7.1e-15 14.7 %
:HMM:SCOP  187->307 1e4fT2 c.55.1.1 * 2.4e-08 25.0 %
:RPS:PFM   195->307 PF02491 * FtsA 3e-07 31.9 %
:HMM:PFM   197->307 PF02491 * FtsA 1.4e-16 34.2 111/172  
:HMM:PFM   9->68 PF12251 * zf-SNAP50_C 0.00011 23.3 60/196  
:HMM:PFM   266->365 PF09028 * Mac-1 0.00023 23.9 88/333  
:BLT:SWISS 86->365 FTSA_BUCAI 2e-09 24.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20844.1 GT:GENE ftsA GT:PRODUCT cell division protein FtsA GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(21444..22553) GB:FROM 21444 GB:TO 22553 GB:DIRECTION - GB:GENE ftsA GB:PRODUCT cell division protein FtsA GB:PROTEIN_ID AAZ20844.1 GB:DB_XREF GI:71061841 GB:GENE:GENE ftsA LENGTH 369 SQ:AASEQ MSDKKFQIIIDCGSSKIRAGAFNEESKNNPFFIESNFYTEQFNLKPDIQKVIASLEKSSNEFIDNINLMIDSSKTISIAISVFKKIEELKLRQDDIIFLIQEAKQQIKKYYSDYNIAHIIINNYKIDNVDYSELPDEIDCQFISLDIIFICLPSELVFRFKNIFSELNISINQIICSSYAKSINYKNNLNLTGEVSFIDIAFKKTSIISFYNDKLIFLDVLPIGGNHITKDISLLLKIDINEAEKLKLNFEKNNEHTDNPNFSLEMLQKIAFARTEEILELCDKSLVSNAKVKTQSKMILMGEGSKILDNKFKDKISFSKDIDFLEETLGDVCQSGYKLRKMYDKQEVVVVPKKQIKQGFFEKLFHFFK GT:EXON 1|1-369:0| BL:SWS:NREP 1 BL:SWS:REP 86->365|FTSA_BUCAI|2e-09|24.6|276/418| BL:PDB:NREP 1 BL:PDB:REP 87->246|1e4fT|1e-06|20.9|158/378| RP:PDB:NREP 1 RP:PDB:REP 4->307|1e4gT|5e-07|16.6|296/375| RP:PFM:NREP 1 RP:PFM:REP 195->307|PF02491|3e-07|31.9|113/164|FtsA| HM:PFM:NREP 3 HM:PFM:REP 197->307|PF02491|1.4e-16|34.2|111/172|FtsA| HM:PFM:REP 9->68|PF12251|0.00011|23.3|60/196|zf-SNAP50_C| HM:PFM:REP 266->365|PF09028|0.00023|23.9|88/333|Mac-1| GO:PFM:NREP 1 GO:PFM GO:0007049|"GO:cell cycle"|PF02491|IPR003494| RP:SCP:NREP 1 RP:SCP:REP 195->307|1e4fT2|4e-07|25.7|113/185|c.55.1.1| HM:SCP:REP 4->186|1e4fT1|7.1e-15|14.7|177/193|c.55.1.1|1/1|Actin-like ATPase domain| HM:SCP:REP 187->307|1e4fT2|2.4e-08|25.0|120/191|c.55.1.1|1/1|Actin-like ATPase domain| OP:NHOMO 60 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------1-11-1---------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------1--------------111111-11---------1--------11--1--1-----1-11-------------------------------------1---------------------------------------------2-------111111111111111----1----------------------------------------------------------------------------------------------------------1---111111111-1-------11111------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------11--------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 300 STR:RPRED 81.3 SQ:SECSTR ###cEEEEEEEEcccEEEEEEEEcccccEEEEEEEccccccccHHHHHHHHHHHHHHHHTccccccEEEEEccTTcEEEEEEEEEEcTTccEEccHHHHHHHHHHHHHHccTTEEEEEEEEEEEEEccccEcccTTEEcEEEEEEEEEEEEHHHHHHTTTHHHHHTTccccEEEEEHHHHHHHHHccHHHHHHcEEEEEcccccEEEEEEETTEEEEEEEEccccHHHHHHHHHHccccHHHHHHHHHHHcccccTTccccEHHHHHHHHHHHHHHHHHHHHH####HHHTccccccEEEEcGGGGc############################################################## DISOP:02AL 349-355| PSIPRED cccccEEEEEEEcccEEEEEEEEEEccccEEEEEcccEEcHHHHHHHHHHHHHHHHHHHccEEEEEEEEcccccEEEEEEEEEEEcccccccHHHHHHHHHHHHHHccccccccEEEEEEEEEEEEEcccccccccccccEEEEEEEEEEEEccHHHHHHHHHHHHccccEEEEEEcHHHHHHHHcccccccccEEEEEEcccEEEEEEEEccEEEEEEEEEHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccHHHcccHHHHHHHHHccccEEEEccccccccHHHHHHHHHccHHHcccccHHHccHHHHHHHHHcc //