[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ftsJ
DDBJ      :ftsJ         FtsJ-like methyltransferase
Swiss-Prot:RRMJ_PELUB   RecName: Full=Ribosomal RNA large subunit methyltransferase J;         EC=2.1.1.-;AltName: Full=rRNA (uridine-2'-O-)-methyltransferase;AltName: Full=23S rRNA m2U2552 methyltransferase;

Homologs  Archaea  35/68 : Bacteria  448/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:203 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->182 1eizA PDBj 2e-26 42.5 %
:RPS:PDB   28->183 3douA PDBj 2e-13 21.7 %
:RPS:SCOP  27->200 1eizA  c.66.1.2 * 4e-44 34.5 %
:HMM:SCOP  1->200 1l9kA_ c.66.1.25 * 1.2e-34 29.3 %
:RPS:PFM   30->199 PF01728 * FtsJ 3e-21 32.4 %
:HMM:PFM   28->200 PF01728 * FtsJ 9.3e-59 45.7 173/181  
:BLT:SWISS 1->203 RRMJ_PELUB e-103 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21468.1 GT:GENE ftsJ GT:PRODUCT FtsJ-like methyltransferase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 634861..635472 GB:FROM 634861 GB:TO 635472 GB:DIRECTION + GB:GENE ftsJ GB:PRODUCT FtsJ-like methyltransferase GB:PROTEIN_ID AAZ21468.1 GB:DB_XREF GI:71062465 GB:GENE:GENE ftsJ LENGTH 203 SQ:AASEQ MKKNRISKNWINKQKRDIYVRQSQVDGYRARSAYKLIEIDEKFKIFKNGISVIDLGASPGSWSQYISRTVKSGRLVSIDLKGMEEIENTIQIKGDFTDLESQEKIKALFKSKVDVVVSDMAVNTTGIKDIDAIYTGELAMEAMNFSKEMLVKEGRFVSKIFLGSSFNEIVALGKKLFKEVKVFKPKSSRKESKESFIICKILR GT:EXON 1|1-203:0| SW:ID RRMJ_PELUB SW:DE RecName: Full=Ribosomal RNA large subunit methyltransferase J; EC=2.1.1.-;AltName: Full=rRNA (uridine-2'-O-)-methyltransferase;AltName: Full=23S rRNA m2U2552 methyltransferase; SW:GN Name=rrmJ; Synonyms=ftsJ; OrderedLocusNames=SAR11_0648; SW:KW Complete proteome; Cytoplasm; Methyltransferase; rRNA processing;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->203|RRMJ_PELUB|e-103|100.0|203/203| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0006364|"GO:rRNA processing"|rRNA processing| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 184->195|kpkssrkeskes| BL:PDB:NREP 1 BL:PDB:REP 27->182|1eizA|2e-26|42.5|153/180| RP:PDB:NREP 1 RP:PDB:REP 28->183|3douA|2e-13|21.7|152/170| RP:PFM:NREP 1 RP:PFM:REP 30->199|PF01728|3e-21|32.4|170/179|FtsJ| HM:PFM:NREP 1 HM:PFM:REP 28->200|PF01728|9.3e-59|45.7|173/181|FtsJ| GO:PFM:NREP 3 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF01728|IPR002877| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01728|IPR002877| GO:PFM GO:0032259|"GO:methylation"|PF01728|IPR002877| RP:SCP:NREP 1 RP:SCP:REP 27->200|1eizA|4e-44|34.5|174/181|c.66.1.2| HM:SCP:REP 1->200|1l9kA_|1.2e-34|29.3|184/0|c.66.1.25|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1075 OP:NHOMOORG 680 OP:PATTERN -----------------------111111111111111111111111111111--------111--11 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-111111111111111111111111111111111-11111111111111111111111111---11--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111---------111111-1-------------------------111111111111111111111111111111111-11111111--111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------1111111111--------------------------------------- 3212332193322333323223333313323333221423234333223231312223333333333333333333333333333333-23232222222323332224353533413223223542529H5-3551112413711222332231413224235331433A35332323G2323322322452344444 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 183 STR:RPRED 90.1 SQ:SECSTR cccGGGcHHHHHHHHHHHHTTccHHHcTTcHHHHHHHHHHHHHccccTTcEEEEEccTTcHHHHHHTTcEEEEEEccccccTTcEEEEccTTcccHHHHHHHHHHHHTcTccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEEccTHHHHHHHHHGGGEEEEEEE#################### DISOP:02AL 1-6, 8-11| PSIPRED cccccHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHccccEEEEEEEEcccccccEEEEEcccccHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccHHHHHHHHHHHccEEEEEEcccccccccEEEEEEEccc //