[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ftsL
DDBJ      :ftsL         cell division protein FtsL
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->54 PF06103 * DUF948 0.00085 22.4 49/90  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20855.1 GT:GENE ftsL GT:PRODUCT cell division protein FtsL GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(35504..35812) GB:FROM 35504 GB:TO 35812 GB:DIRECTION - GB:GENE ftsL GB:PRODUCT cell division protein FtsL GB:NOTE ingrowth of wall at septum GB:PROTEIN_ID AAZ20855.1 GB:DB_XREF GI:71061852 GB:GENE:GENE ftsL LENGTH 102 SQ:AASEQ MKQLVVAVILVLILITSLIKNSTKEIEDQIFIVKENIRPLKSELEDVLLEFNYLSSPEKLVQYQTQYFEKDLIKIEIMNIKEIFKNNETLEIKDLISKNGNE GT:EXON 1|1-102:0| TM:NTM 1 TM:REGION 1->23| SEG 4->19|lvvavilvlilitsli| HM:PFM:NREP 1 HM:PFM:REP 5->54|PF06103|0.00085|22.4|49/90|DUF948| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 98-102| PSIPRED cHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccc //