[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ftsQ
DDBJ      :ftsQ         cell division protein FtsQ
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:225 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   86->220 2vh2B PDBj 3e-04 24.1 %
:HMM:PFM   37->103 PF08478 * POTRA_1 8.6e-11 20.9 67/69  
:HMM:PFM   108->217 PF03799 * FtsQ 2.3e-07 21.5 107/117  
:BLT:SWISS 86->218 FTSQ_RHIRD 2e-06 22.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20845.1 GT:GENE ftsQ GT:PRODUCT cell division protein FtsQ GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(22553..23230) GB:FROM 22553 GB:TO 23230 GB:DIRECTION - GB:GENE ftsQ GB:PRODUCT cell division protein FtsQ GB:NOTE FtsQ GB:PROTEIN_ID AAZ20845.1 GB:DB_XREF GI:71061842 GB:GENE:GENE ftsQ LENGTH 225 SQ:AASEQ MHQSIGKKNKIIIYLLFLFILSTTSAKFINDQKKLSSSITKINITGLSERKNLEILDNLNNLLYKSIFVINEEEIIKILEKHNIIQEFNIKKIYPSTLNIKIKPTKLIARVSNNSQYLVGANGKLIEDKSNNELLPYIFGEFNSQDFLSFKKNIEKSMWSFSNLKELSFFPSGRWDILTDKDILIKLPQEHIVASLNLSKELINNDNFKDFKFIDLRIKSHLVAK GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 86->218|FTSQ_RHIRD|2e-06|22.6|133/210| SEG 11->21|iiiyllflfil| SEG 52->63|nleildnlnnll| SEG 70->85|ineeeiikilekhnii| BL:PDB:NREP 1 BL:PDB:REP 86->220|2vh2B|3e-04|24.1|133/201| HM:PFM:NREP 2 HM:PFM:REP 37->103|PF08478|8.6e-11|20.9|67/69|POTRA_1| HM:PFM:REP 108->217|PF03799|2.3e-07|21.5|107/117|FtsQ| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 59.1 SQ:SECSTR #####################################################################################EEEEEEEcccccEEEEEEEccccccc##ccccEEcTTccEEccccccccccEEEcTTcHHHHHHHHHHHHHHHHHTTcccEEEEETTTEEEEcccccccEEEEcccHHHHHHHHHHHTTccccccccEEEccccc##### DISOP:02AL 1-5| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEccccccHHHHHHHHcccccccEEEEcHHHHHHHHHHcccEEEEEEEEEcccEEEEEEEEEEEEEEEEcccEEEEccccEEEEccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHccEEEEEccEEEEEEEcccEEEEccccHHHHHHHHHHHHHcccccccEEEEEEEEcccEEEc //