[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ftsW
DDBJ      :ftsW         cell division protein FtsW
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  400/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:374 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   48->347 PF01098 * FTSW_RODA_SPOVE 2e-21 28.2 %
:HMM:PFM   22->371 PF01098 * FTSW_RODA_SPOVE 1.5e-78 33.4 347/359  
:BLT:SWISS 57->346 RODA_HAEIN 1e-16 23.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20850.1 GT:GENE ftsW GT:PRODUCT cell division protein FtsW GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(27490..28614) GB:FROM 27490 GB:TO 28614 GB:DIRECTION - GB:GENE ftsW GB:PRODUCT cell division protein FtsW GB:PROTEIN_ID AAZ20850.1 GB:DB_XREF GI:71061847 GB:GENE:GENE ftsW LENGTH 374 SQ:AASEQ MINNSSLNSIYYNWWKNIDKTIFLLIIILFSLGLFFSLVSTSFIASDKLDTNNYFFFFKHLVYIFIGLLTLVFFSSLSEKNLFRFSIYLFFITLFFLFLVPIFGTEVKGSKRWLNLFFLPQFQPIELLKPFIIIFVATILCSEKNYNIYIKYLLTIISIIPTGLLLIMQPDIGQTLLVFLSWVILVFVSGINLLFILLFISLSIISLLYVVFFIPKFIYIKSRILSFFNPDGGTHNFQSDKAIEAISSGGFFGKGIGEGTLKTRVPEAHTDYIVSVISEEFGVIAIIFLLILFLFFIYSVFKKIYLEKSEKNKLVLTGSISLIIFQALIHLGVNIRLFPTTGMTLPFLSYGGSSIIGVSILSGIILNLTKRKIN GT:EXON 1|1-374:0| BL:SWS:NREP 1 BL:SWS:REP 57->346|RODA_HAEIN|1e-16|23.2|284/371| TM:NTM 10 TM:REGION 23->45| TM:REGION 56->78| TM:REGION 85->107| TM:REGION 122->143| TM:REGION 148->170| TM:REGION 174->196| TM:REGION 200->221| TM:REGION 277->299| TM:REGION 313->335| TM:REGION 348->369| SEG 2->13|innsslnsiyyn| SEG 22->43|iflliiilfslglffslvstsf| SEG 85->103|fsiylffitlfflflvpif| SEG 193->208|llfillfislsiisll| SEG 246->259|issggffgkgigeg| SEG 286->297|iifllilflffi| SEG 348->368|lsyggssiigvsilsgiilnl| RP:PFM:NREP 1 RP:PFM:REP 48->347|PF01098|2e-21|28.2|298/357|FTSW_RODA_SPOVE| HM:PFM:NREP 1 HM:PFM:REP 22->371|PF01098|1.5e-78|33.4|347/359|FTSW_RODA_SPOVE| GO:PFM:NREP 2 GO:PFM GO:0007049|"GO:cell cycle"|PF01098|IPR001182| GO:PFM GO:0016021|"GO:integral to membrane"|PF01098|IPR001182| OP:NHOMO 485 OP:NHOMOORG 400 OP:PATTERN -------------------------------------------------------------------- 111---------------------------------11--------------------------------------------11-221--------1-----11--1---1-------------1--------------11-----1--1----1-----1--1---11-1-----1-----1------1-1-2111111112111111223311112---11---11111---2222222222222212222-1-1----2-1--------------1--------------------------------------------211122221222-2-11--111111311--1-1112212121-1111-11---211111111111111111111111111111111-11111111111111111111111111211-1-1-11---111111111111121111--------1111111111111111-1-2111111--------------------------------11------11-----1--11111---------111-111--1111----11-11111-1-11------11---11----------------------1111112211111111-22111111211111-1111-1--111---2------------------------------------22--1---1----------1-1--------1-------1----1--1----------1-1122212112112111122222221-11-11111-11111111121---------1233111111222221111111111----1-1---------------1---------------------------2212111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 373-374| PSIPRED cccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccHHHHHHHHHHHcccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHccc //