[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ftsY
DDBJ      :ftsY         cell division particle
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  898/915 : Eukaryota  193/199 : Viruses  0/175   --->[See Alignment]
a.24.13b.65.1c.37.1
:305 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   127->300 2qy9A PDBj 5e-46 47.1 %
:RPS:PDB   138->264 1augA PDBj 3e-28 12.2 %
:RPS:SCOP  14->50 1ftsA1  a.24.13.1 * 9e-05 32.4 %
:RPS:SCOP  144->261 1f3uA  b.65.1.1 * 4e-31 17.4 %
:HMM:SCOP  1->81 1vmaA1 a.24.13.1 * 1.7e-15 27.2 %
:HMM:SCOP  93->305 1ls1A2 c.37.1.10 * 1.7e-48 32.9 %
:RPS:PFM   126->297 PF00448 * SRP54 5e-45 53.6 %
:HMM:PFM   103->301 PF00448 * SRP54 4.9e-73 49.7 193/196  
:HMM:PFM   9->76 PF02881 * SRP54_N 9.1e-12 21.5 65/75  
:HMM:PFM   78->119 PF10236 * DAP3 0.00086 28.2 39/309  
:BLT:SWISS 14->300 FTSY_RICTY 1e-51 37.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21080.1 GT:GENE ftsY GT:PRODUCT cell division particle GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 261173..262090 GB:FROM 261173 GB:TO 262090 GB:DIRECTION + GB:GENE ftsY GB:PRODUCT cell division particle GB:PROTEIN_ID AAZ21080.1 GB:DB_XREF GI:71062077 GB:GENE:GENE ftsY LENGTH 305 SQ:AASEQ MGIFDKFKIGFKKSASTFTSGLRDIIVKKEIDDKTLDQIEEYLIQSDVGLVAAEEIKKIIAQEKIDPKKDIMHEVNLILRNYIVTLMKPLENENFFNKKEKLNAVLVSGVNGVGKTTTIGKVGKILKSNGNKVMFSACDTFRAAAIEQLESWANKIDVQITKSTQGSDPASVAYKAIEEALKNDFNHVLIDTAGRLQNKKNLMEEYKKIAHVTKKIDPDAPHDVILVLDATSGQNVISQVEEFNKIIPLTGLIMTKLDGTAKGGILLALAKKYKLPIIALGLGEKEDDLQIFNAEKFAEAFTQIN GT:EXON 1|1-305:0| BL:SWS:NREP 1 BL:SWS:REP 14->300|FTSY_RICTY|1e-51|37.5|285/303| SEG 2->13|gifdkfkigfkk| SEG 52->65|aaeeikkiiaqeki| SEG 90->103|lenenffnkkekln| SEG 109->125|gvngvgktttigkvgki| BL:PDB:NREP 1 BL:PDB:REP 127->300|2qy9A|5e-46|47.1|174/300| RP:PDB:NREP 1 RP:PDB:REP 138->264|1augA|3e-28|12.2|123/210| RP:PFM:NREP 1 RP:PFM:REP 126->297|PF00448|5e-45|53.6|166/196|SRP54| HM:PFM:NREP 3 HM:PFM:REP 103->301|PF00448|4.9e-73|49.7|193/196|SRP54| HM:PFM:REP 9->76|PF02881|9.1e-12|21.5|65/75|SRP54_N| HM:PFM:REP 78->119|PF10236|0.00086|28.2|39/309|DAP3| GO:PFM:NREP 2 GO:PFM GO:0005525|"GO:GTP binding"|PF00448|IPR000897| GO:PFM GO:0006614|"GO:SRP-dependent cotranslational protein targeting to membrane"|PF00448|IPR000897| RP:SCP:NREP 2 RP:SCP:REP 14->50|1ftsA1|9e-05|32.4|37/84|a.24.13.1| RP:SCP:REP 144->261|1f3uA|4e-31|17.4|115/118|b.65.1.1| HM:SCP:REP 1->81|1vmaA1|1.7e-15|27.2|81/0|a.24.13.1|1/1|Domain of the SRP/SRP receptor G-proteins| HM:SCP:REP 93->305|1ls1A2|1.7e-48|32.9|207/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 2466 OP:NHOMOORG 1158 OP:PATTERN 22222222111222222222222222222222222222222222222222222222222222222-22 2222222222222222222-22222222222222222222222222122222222222222222222222222222222222222222222222222--222222222222222222222222222222222222222222---2222222222222222222222222222222222222222222222-22222222222222222222332222232222323333332222222222222222122222221222222222222222222222122222222222222222222222222222222222222222222232222222222222232223222323222322322222222322223222222222222222222222222222222222222222-22222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222333322322222222233222222222232222222222332222222222323222222222222222222222-2232222222222222222222222222-2222222222222222222222222222222222222222222222222122222222222222222222222222222222222222222222222222212222222222222222222222222222222222222222222222222222222222222222222------2222222222222222-22222222222222222222233322232222 2212221-622222221222222222222222222222112222222222222211222212222222222-2222221222222222-222122221222222222225324222211221213313-2C2-223222121222122122-232233124422222223812324434s44444458B1654432224 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 272 STR:RPRED 89.2 SQ:SECSTR ###############################cTHHHHHHHHHHHTTTccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHTccccccccccccccccEEEEEccTTccHHHHHHHHHHHHTcccccEEEEcccccccccTTccccccccccTTcHHHHccEEEccccHHHHHHHHHTTccccccccccccHHHHHHHHHHHHHHHHcTTcEEEEEEEcccGGGccccccccccHHHHHHHHHHHHHHHHHccccccccHHTccHHHHcccEEEEEccccTTcEEEccHHHHHHHHHc## DISOP:02AL 11-22, 92-96| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccEEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHccc //