[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : fumC
DDBJ      :fumC         Fumarate hydratase class II (Fumarase C)
Swiss-Prot:             

Homologs  Archaea  52/68 : Bacteria  767/915 : Eukaryota  180/199 : Viruses  0/175   --->[See Alignment]
a.127.1
:462 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->456 3gtdA PDBj e-146 58.3 %
:RPS:PDB   4->461 3e04A PDBj e-136 57.2 %
:RPS:SCOP  3->458 1fuoA  a.127.1.1 * e-145 52.0 %
:HMM:SCOP  3->461 1j3uA_ a.127.1.1 * 1.6e-159 36.2 %
:RPS:PFM   70->340 PF00206 * Lyase_1 3e-55 45.1 %
:RPS:PFM   407->458 PF10415 * FumaraseC_C 1e-13 61.5 %
:HMM:PFM   11->341 PF00206 * Lyase_1 1.2e-109 48.1 310/312  
:HMM:PFM   407->461 PF10415 * FumaraseC_C 1.7e-25 58.2 55/55  
:BLT:SWISS 4->461 FUMC_BRUSU e-154 58.7 %
:PROS 316->325|PS00163|FUMARATE_LYASES
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20837.1 GT:GENE fumC GT:PRODUCT Fumarate hydratase class II (Fumarase C) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 10957..12345 GB:FROM 10957 GB:TO 12345 GB:DIRECTION + GB:GENE fumC GB:PRODUCT Fumarate hydratase class II (Fumarase C) GB:PROTEIN_ID AAZ20837.1 GB:DB_XREF GI:71061834 GB:GENE:GENE fumC LENGTH 462 SQ:AASEQ MKLRKEFDSIGSINVPSDRYWGASTQRSNKFFNIGKILVNISIIKSIAIIKRSAALVHYKEKQINKKITNSIIKASDEVIKGKLDENFPLKVWQTGSGTQTNMNVNEVIANRAIEILGGKKGSKKPVHPNDHVNKSQSTNDVFPTAMHISVAQETISKLLPNLKILEKELAKKSKEFKNIIKIGRTHLQDATPLSLGQEFSGYQVQLKKCIERVELSLKEIYFLAQGGTAVGTGINSKKGFDKKIVKEIAKYTKIPFKPAPNKFAELAAHDSIVNFSGTLNTCAVALMKISNDVRFLGSGPRAGYGELILPENEPGSSIMPGKVNPTQCEAVTMVCAKVMGNHNGITIAGSHGHFELNVFKPMIAHNVLQSIDLIADSTKNFAIYCVKGIKANKKRIKEHLDNSLMLVTALAPHIGYDNAAKIAKTALKNGTTLKYETLKTGLVDEKDYEKIVDPKKMIYPS GT:EXON 1|1-462:0| BL:SWS:NREP 1 BL:SWS:REP 4->461|FUMC_BRUSU|e-154|58.7|458/463| PROS 316->325|PS00163|FUMARATE_LYASES|PDOC00147| SEG 41->55|isiiksiaiikrsaa| BL:PDB:NREP 1 BL:PDB:REP 4->456|3gtdA|e-146|58.3|453/455| RP:PDB:NREP 1 RP:PDB:REP 4->461|3e04A|e-136|57.2|451/456| RP:PFM:NREP 2 RP:PFM:REP 70->340|PF00206|3e-55|45.1|255/302|Lyase_1| RP:PFM:REP 407->458|PF10415|1e-13|61.5|52/55|FumaraseC_C| HM:PFM:NREP 2 HM:PFM:REP 11->341|PF00206|1.2e-109|48.1|310/312|Lyase_1| HM:PFM:REP 407->461|PF10415|1.7e-25|58.2|55/55|FumaraseC_C| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF00206|IPR000362| GO:PFM GO:0006099|"GO:tricarboxylic acid cycle"|PF10415|IPR018951| GO:PFM GO:0016829|"GO:lyase activity"|PF10415|IPR018951| RP:SCP:NREP 1 RP:SCP:REP 3->458|1fuoA|e-145|52.0|456/456|a.127.1.1| HM:SCP:REP 3->461|1j3uA_|1.6e-159|36.2|458/462|a.127.1.1|1/1|L-aspartase-like| OP:NHOMO 1581 OP:NHOMOORG 999 OP:PATTERN 11-1--1211111112-11211-1111111111111-122222-1-----11-111--1112221-11 1221122222322211111-11111211111111111246111112212222323111--11121132111-111111----112-221111-211--1322111111111-1-11-11111111---1111--32111111111111111112111111121111111111111111111111111122-122444444343344444223332443-1221222222222111111111111111111111-1122221111331122-212111--111--------------------------------111--111-1--23-------1-11-22-----1-221--1122211-41111111--1221111221223123111112111222222222222-3323322241213221333324112121111311121121111111111111211111111111111111111111111111-1111111111112222221111111121111112211211-2111-11122113222111---212222222111122312-2123-323321111111222221212-42143122222321222222211--111222111111112222212----11---1222-21111------22222222222222222-2222422222222222222222332232222222222222222222222222222222222222211211111111111121322222222222222222222-2122213333343323333233211111111111113222222221111111111111111---1332222--------1--------------------1------2112222212111 ----211-----1122122111111111111111111111111111111112121211111111211112113121111112122111-12111111111111221-1112121-111112--111121291-21111111111-1111111111121221-12112512712332-12S2221131-32311131113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 460 STR:RPRED 99.6 SQ:SECSTR ##cEEEEETTEEEEEETTccccHHHHHHHHHcccccccGGGcccHHHHHHHHHHHHHHHHGGTccHHHHHHHHHHHHHHHTTccGGGccccccccTTcHHHHHHHHHHHHHHHHHHTTccTTcccccccccccTTTccHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHTTTcEEEEEETTEEEEEEEHHHHHHHHHHHHHHHHHHHHHTcTTTcEEcTTcTTTcccTTccTTHHHHHHHHHHHHHTcccEEcccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccccccEEcEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHTccTTccccHHHHHHHHHHHHHHHHHHHHHHHHHTGGGcEEcHHHHHHHHHHccGGGGGGHHHHcHHHHHHHHHHHHHHTccHHHHHHHHTcccHHHHHHHccGGGccccH DISOP:02AL 461-462| PSIPRED ccEEEEEcccccccccHHHHccccHHHHHHccccccEEccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccHHHHHHHHHHHHHcccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHcHHHccccc //