[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : fur
DDBJ      :fur          Ferric uptake regulation protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  709/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:136 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->135 1mzbA PDBj 7e-27 40.6 %
:RPS:PDB   10->85 2co5B PDBj 1e-04 13.7 %
:RPS:SCOP  4->135 1mzbA  a.4.5.42 * 8e-27 37.9 %
:HMM:SCOP  3->135 1mzbA_ a.4.5.42 * 1.5e-37 40.6 %
:RPS:PFM   13->129 PF01475 * FUR 7e-22 46.2 %
:HMM:PFM   12->130 PF01475 * FUR 3.5e-45 51.3 119/120  
:BLT:SWISS 1->135 FUR_RHILV 3e-47 57.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21203.1 GT:GENE fur GT:PRODUCT Ferric uptake regulation protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 372766..373176 GB:FROM 372766 GB:TO 373176 GB:DIRECTION + GB:GENE fur GB:PRODUCT Ferric uptake regulation protein GB:PROTEIN_ID AAZ21203.1 GB:DB_XREF GI:71062200 GB:GENE:GENE fur LENGTH 136 SQ:AASEQ MSENIEQKCLAKGVKLTDQRKIIAKVMSESNDHPDVDELYNRVSKIDPKISIATVYRTVKLFEESGILAKHDFKGGKARYEELNEGHHDHLIDVKSGEIIEFVDEEIEKLQEKIADKYGYRLVDHKLELYGVKKKS GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 1->135|FUR_RHILV|3e-47|57.8|135/142| BL:PDB:NREP 1 BL:PDB:REP 1->135|1mzbA|7e-27|40.6|133/133| RP:PDB:NREP 1 RP:PDB:REP 10->85|2co5B|1e-04|13.7|73/94| RP:PFM:NREP 1 RP:PFM:REP 13->129|PF01475|7e-22|46.2|117/120|FUR| HM:PFM:NREP 1 HM:PFM:REP 12->130|PF01475|3.5e-45|51.3|119/120|FUR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01475|IPR002481| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01475|IPR002481| RP:SCP:NREP 1 RP:SCP:REP 4->135|1mzbA|8e-27|37.9|132/133|a.4.5.42| HM:SCP:REP 3->135|1mzbA_|1.5e-37|40.6|133/134|a.4.5.42|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 953 OP:NHOMOORG 711 OP:PATTERN --------------------------------------------------21---------------- 121---11111-1-11111-1111111111111111111111-11-11------11-1--111---1-1------1------221233---1-------111111-2111---------------11113221122---11334-141-111111221--11-1-111112111-1--1--1------111223222222222222222225523222232222222222225222222222222222233222-1----1---1111--111---111---1111111-----------1111111111111111111111122232111111122222662333121223113-22421123234342---121111111111--1112111111111111111111---------2-1-2111111111111111111111111111111111111111211-----------------------------11111111111111111211111121111111111222211222111113111111111111111111111111111242111141342221212223122222212222331222222211111111111-1211113111111111122112111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--111111111-1111111111111111111111111111111111111111111111111111111111111111222222221211111111111111111-222222----------1--------------------------1--1111111-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 134 STR:RPRED 98.5 SQ:SECSTR cHHHHHHH#ccTTccHHHHHHHHHHHHTTcTEEEGGGHHHHHHHHHcccccHHHHHHHHHHHHHTTcEEEEEEccTTccEEEEcHccccHHHHTTTccEEEEccHHHHHHHHHHHHTTTccccccccEEEEcccc# PSIPRED cHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEcccEEEEEEccccccEEEEEcccccEEEcccccHHHHHHHHHHHHccEEEEEEEEEEEEcccc //