[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : galE
DDBJ      :galE         UDPglucose 4-epimerase
Swiss-Prot:             

Homologs  Archaea  59/68 : Bacteria  752/915 : Eukaryota  177/199 : Viruses  1/175   --->[See Alignment]
c.2.1
:318 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   67->293 1gy8D PDBj 3e-28 33.5 %
:RPS:PDB   33->247 3c4tA PDBj 1e-17 9.2 %
:RPS:SCOP  21->263 1sb8A  c.2.1.2 * 3e-27 26.8 %
:HMM:SCOP  3->318 1eq2A_ c.2.1.2 * 2.5e-52 31.6 %
:RPS:PFM   48->236 PF01370 * Epimerase 1e-19 38.8 %
:HMM:PFM   4->234 PF01370 * Epimerase 6.2e-39 33.5 215/238  
:BLT:SWISS 28->295 GALE_LACHE 6e-30 33.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21390.1 GT:GENE galE GT:PRODUCT UDPglucose 4-epimerase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 560488..561444 GB:FROM 560488 GB:TO 561444 GB:DIRECTION + GB:GENE galE GB:PRODUCT UDPglucose 4-epimerase GB:PROTEIN_ID AAZ21390.1 GB:DB_XREF GI:71062387 GB:GENE:GENE galE LENGTH 318 SQ:AASEQ MRKVLITGGAGYIGAATTQLFLKKNFLVFAVDNLSTGKNLLTHKNYLFIKSDYSSNHILNLLKKEKIQDVIHLAASIDNNESVLNPKKYYQNNFFKLIKFLENCKKAKIKNFIFSSSAAVYGEVKTFKPLAENFILTPSSPYGISKMKGEMLIRKKKYFNSIILRYFNVAGPTFDNKFRQNFKSYKHLLKKLNEINFSRNKNIFKINGKNYDTIDGTCVRDFVHVQDIANINYRSLISIKKILKNDYSLTLNCGSGKENSVLQIVKKFKIISKKNFKIIFTKPRIGDPPFLLSDNRLFKKKLGLKFFGINKIIKDLIK GT:EXON 1|1-318:0| BL:SWS:NREP 1 BL:SWS:REP 28->295|GALE_LACHE|6e-30|33.5|263/330| SEG 6->18|itggagyigaatt| SEG 264->282|ivkkfkiiskknfkiiftk| SEG 297->308|lfkkklglkffg| BL:PDB:NREP 1 BL:PDB:REP 67->293|1gy8D|3e-28|33.5|227/364| RP:PDB:NREP 1 RP:PDB:REP 33->247|3c4tA|1e-17|9.2|184/241| RP:PFM:NREP 1 RP:PFM:REP 48->236|PF01370|1e-19|38.8|170/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 4->234|PF01370|6.2e-39|33.5|215/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 21->263|1sb8A|3e-27|26.8|224/341|c.2.1.2| HM:SCP:REP 3->318|1eq2A_|2.5e-52|31.6|291/307|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 1808 OP:NHOMOORG 989 OP:PATTERN --1-1--1111111112311--21311212-1233222121211122312342122222221112-11 221-31122231111------1--1-------111112121221121-1111221111--111121142411222222111122334232311211---22223211321--------------12222122224211111---113314441111121112212112231111232323213111111121223343434323443443544223361321221111211242111111111111113---141111111212241111232121211121122222233323123223-------------111222111131-514443443132312212224141-21121125233212112121211321221-----113222112222322222222212-11111111131133313334434311211111232221-1111111111221-21-----------------------------212211111--1112111111122211111112111221--2112111111121-1112111122222222112222-12231311242213231221432--2-111223211222332111211111113111-334321222121232322222222323113--13121------11122221112112111-1211122211111--11-1222112131-11111111111111412111121-211111111111--1-22222----111121111111111111113111111113311---223-1223111111222222221123411111231331111111---------231133221-11--1-1-1----------1-1---13-1-----1122311111222 --11211-211135512232342232211-11111111-11111113312333213222333112-11-1-11-111-1111112132-12121212121121323-162221111-11-1-2131121852-222111-2-111-111-11-111-1149724121122K12321232S64221D7FA3C33333441 -----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 296 STR:RPRED 93.1 SQ:SECSTR cEEEEETTTTcHHHHHHHHHHHTTTccEEEEEHHHHHHHHHHHTTcccccHHcTTcccccTHHHHHHHHHHHHHHHHHHHHcTHHHHHHHHHHHccHHHHHHHHHHTTGGGccccccHHHHHEEEHHHHHHHHHHHTTcccccccTHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHcccTTHHHHHHHHHHTTcccccccGGHTTccccHHHHHHHHHHccccEEEcccEEcTEEEEETTTEEEcEEEcHHHHHTccccHHHHHHHHHHcccccEEEEcccTTcccEEccccH###################### PSIPRED ccEEEEEccccHHHHHHHHHHHHcccEEEEEEccccHHHHccccccEEEEcccccHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccHHHHHHHHHHHHHHccccccEEEEccccccccccEEEccEEHHHHHHHHHHHHHHHHHHHcccccEEEEccccccEEHHHHHHHHHHHHcccccEEEcccccccccEEcccHHHHHHHHccccccHHHHHHHHHc //