[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : gap
DDBJ      :gap          glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  892/915 : Eukaryota  190/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:335 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->328 3docA PDBj 3e-94 50.0 %
:RPS:PDB   3->331 3e6aA PDBj 6e-77 42.6 %
:RPS:SCOP  2->180 1a7kA1  c.2.1.3 * 2e-32 33.1 %
:RPS:SCOP  153->315 1a7kA2  d.81.1.1 * 2e-37 45.4 %
:HMM:SCOP  2->173 1u8fO1 c.2.1.3 * 7.4e-60 44.7 %
:HMM:SCOP  153->315 2b4rO2 d.81.1.1 * 5.9e-69 54.6 %
:RPS:PFM   4->153 PF00044 * Gp_dh_N 2e-33 46.6 %
:RPS:PFM   158->313 PF02800 * Gp_dh_C 9e-39 47.4 %
:HMM:PFM   158->314 PF02800 * Gp_dh_C 5.4e-61 49.7 157/157  
:HMM:PFM   3->153 PF00044 * Gp_dh_N 5.3e-54 49.0 149/151  
:BLT:SWISS 1->328 G3P2_RHOSH 1e-88 49.1 %
:PROS 151->158|PS00071|GAPDH

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21407.1 GT:GENE gap GT:PRODUCT glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(573722..574729) GB:FROM 573722 GB:TO 574729 GB:DIRECTION - GB:GENE gap GB:PRODUCT glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) GB:PROTEIN_ID AAZ21407.1 GB:DB_XREF GI:71062404 GB:GENE:GENE gap LENGTH 335 SQ:AASEQ MTIKVGINGMGRIGRMVIRAIIESQNKNIEIKHINNRSNSEASCSLIKYDSIHGKFNADLNYDEKHLIINNNKITFSQESNIEDINWKKFDVDYVFECTGKFNSKEKLLAHIKNGAKKVIVSAPCKNADKTIVYGVNENILTKDDQIVSAASCTTNCLAPVANILNETFEIEKGFMTTIHAFTSDQRILDNSHKDPRRARSASQSIVPTSTGASKAIGEIIPSLKGKLEGIAMRVPTPNVSLIELVFCTKKEMSKETINEAFTIASKEQSKKVLEVTLEKLVSIDFNHNSASAIVDLSLTNVVGKNMGKISAWYDNEWGFSNRMCDIAEHLHQVS GT:EXON 1|1-335:0| BL:SWS:NREP 1 BL:SWS:REP 1->328|G3P2_RHOSH|1e-88|49.1|326/333| PROS 151->158|PS00071|GAPDH|PDOC00069| BL:PDB:NREP 1 BL:PDB:REP 1->328|3docA|3e-94|50.0|328/335| RP:PDB:NREP 1 RP:PDB:REP 3->331|3e6aA|6e-77|42.6|326/334| RP:PFM:NREP 2 RP:PFM:REP 4->153|PF00044|2e-33|46.6|148/148|Gp_dh_N| RP:PFM:REP 158->313|PF02800|9e-39|47.4|156/156|Gp_dh_C| HM:PFM:NREP 2 HM:PFM:REP 158->314|PF02800|5.4e-61|49.7|157/157|Gp_dh_C| HM:PFM:REP 3->153|PF00044|5.3e-54|49.0|149/151|Gp_dh_N| GO:PFM:NREP 8 GO:PFM GO:0004365|"GO:glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) activity"|PF00044|IPR000173| GO:PFM GO:0006006|"GO:glucose metabolic process"|PF00044|IPR000173| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF00044|IPR000173| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00044|IPR000173| GO:PFM GO:0004365|"GO:glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) activity"|PF02800|IPR000173| GO:PFM GO:0006006|"GO:glucose metabolic process"|PF02800|IPR000173| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF02800|IPR000173| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02800|IPR000173| RP:SCP:NREP 2 RP:SCP:REP 2->180|1a7kA1|2e-32|33.1|169/189|c.2.1.3| RP:SCP:REP 153->315|1a7kA2|2e-37|45.4|163/169|d.81.1.1| HM:SCP:REP 2->173|1u8fO1|7.4e-60|44.7|170/0|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 153->315|2b4rO2|5.9e-69|54.6|163/0|d.81.1.1|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| OP:NHOMO 2323 OP:NHOMOORG 1090 OP:PATTERN ----------------1-------1--1111------------1--------------------1--- 1111222222221211111-111111111111111111221121121211112222221111211212321111111111111111111111111111111333322113111111111111111111111111112223311121222322233332222322222332322222122122111111111122222222222222222222222222222222211111124222222222222222222222111121111111-1111111112221111111112111111111111111111111111111111111112311222222212112221111211112113333222112111111111121111111111111121111112111111111111-1111111111111111111111111211143233223441111111111111111111111111111-------------111111111111111111111111111111111111111223211111131111212111121112212222222121223114332222222222232221433111111132111111111122222222212223113323314344446444444544444445441-1131211111143322322333233333-332333332333333233344322222232223222322222233323233112222222222221111111111111135441111111111111112222222222313333333353334433311111111123334444444444411111111111111113111111111111111111111-1-1111121111111112---1111111111111 1111111-63421121111233432321111111111111111111211211111111111113113221222135333411111162-111121922211112341162227224222112B1V*2G2Ar2-32N1222Y22A3-21214--A23122--22211251-744313345*33343G7PB1756569652 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 334 STR:RPRED 99.7 SQ:SECSTR ccEEEEEEcccHHHHHHHHHHHHTHcccEEEEEEEccccHHHHHHHccccccccccccccEEEcccccETTEEcEEEccccGGGccGGGTTccEEEETTcccccTTGGGGTTTTTccEEEEccccccccccccTTTcTTcccTTccEEEcccTTHHHHHHHHHHHHHHHcEEEEEEEcEEEccTTcccccccccccGGGcccccccEEccccHHHHHHHHcGGGTTccccccEEEcccccEEEEEEEEEcccccHHHHHHHHHHHTTTTccTTEEEEccccccGGGTTccccEEEETTTcccccTTcEEEEEEEcTTHHHHHHHHHHHHHHHHH# PSIPRED ccEEEEEEcccHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHccccccccccccEEEccEEEEccEEEEEEEccHHccccHHHHcccEEEEcccccccHHHHHHHHHccccEEEEEcccccccEEEEEcccHHHcccccEEEEEccccccccccHHHHHcccccEEEEEEEEEEEccccccccccccccccccccHHHccccccccccEEEccccccccccccccEEEEEcccEEEEEEEEEccccccHHHHHHHHHHHHccccccEEEEccccEEEEEEEEEEEEEEEEccccEEEcccEEEEEEEEcccccHHHHHHHHHHHHHHcc //