[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : gidB
DDBJ      :gidB         Glucose inhibited division protein
Swiss-Prot:RSMG_PELUB   RecName: Full=Ribosomal RNA small subunit methyltransferase G;         EC=2.1.1.-;AltName: Full=16S rRNA 7-methylguanosine methyltransferase;         Short=16S rRNA m7G methyltransferase;

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:213 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  48->189 1jsxA  c.66.1.20 * 8e-07 21.1 %
:HMM:SCOP  1->188 1xdzA_ c.66.1.20 * 1.2e-20 25.1 %
:HMM:PFM   24->197 PF02527 * GidB 4.3e-31 28.6 168/184  
:BLT:SWISS 1->202 RSMG_PELUB 6e-94 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21174.1 GT:GENE gidB GT:PRODUCT Glucose inhibited division protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 344954..345595 GB:FROM 344954 GB:TO 345595 GB:DIRECTION + GB:GENE gidB GB:PRODUCT Glucose inhibited division protein GB:PROTEIN_ID AAZ21174.1 GB:DB_XREF GI:71062171 GB:GENE:GENE gidB LENGTH 213 SQ:AASEQ MEEIFKNYPLLKNQNVPRETLIEFDLFISMLQEENEKINIISKETAKNEVIRERHIVDSAQIIEFVDLNSNIITDIGSGGGMPGIIISIMIKNQKNLAKVHLYEKSHHKSSFLRKVSRDLKLNTEVMQENIFEAEKLDSGTIMARAFKPLPIILDLVYKNFNSYKNLIVFMGKNGEKVLEETLMNWDFDFEKKKSITSEDSFLLNIKKIKKKN GT:EXON 1|1-213:0| SW:ID RSMG_PELUB SW:DE RecName: Full=Ribosomal RNA small subunit methyltransferase G; EC=2.1.1.-;AltName: Full=16S rRNA 7-methylguanosine methyltransferase; Short=16S rRNA m7G methyltransferase; SW:GN Name=rsmG; OrderedLocusNames=SAR11_0352; SW:KW Complete proteome; Cytoplasm; Methyltransferase; rRNA processing;S-adenosyl-L-methionine; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->202|RSMG_PELUB|6e-94|100.0|202/213| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0006364|"GO:rRNA processing"|rRNA processing| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 33->44|eenekiniiske| SEG 76->91|igsgggmpgiiisimi| SEG 203->212|llnikkikkk| HM:PFM:NREP 1 HM:PFM:REP 24->197|PF02527|4.3e-31|28.6|168/184|GidB| RP:SCP:NREP 1 RP:SCP:REP 48->189|1jsxA|8e-07|21.1|133/193|c.66.1.20| HM:SCP:REP 1->188|1xdzA_|1.2e-20|25.1|179/0|c.66.1.20|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1-----------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 211-213| PSIPRED cHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccEEccEEcccccHHHHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHHHccccEEEEccHHHcccccccEEEEEccccHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHccccEEEEEEEEEccccEEEEEccccccc //