[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : glcE
DDBJ      :glcE         (S)-2-hydroxy-acid oxidase
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  407/915 : Eukaryota  29/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.58.32
:422 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->190 2uuuC PDBj 7e-06 26.4 %
:RPS:PDB   16->420 1ahuA PDBj 4e-28 12.3 %
:RPS:SCOP  15->193 1fiqB2  d.145.1.3 * 1e-18 8.3 %
:RPS:SCOP  317->420 1f0xA1  d.58.32.2 * 3e-09 11.7 %
:HMM:SCOP  15->194 1e8gA2 d.145.1.1 * 4.4e-30 28.8 %
:HMM:SCOP  249->421 1e8gA1 d.58.32.1 * 5e-18 23.1 %
:RPS:PFM   17->157 PF01565 * FAD_binding_4 1e-07 24.8 %
:HMM:PFM   15->155 PF01565 * FAD_binding_4 4.5e-18 29.5 132/138  
:HMM:PFM   399->418 PF02913 * FAD-oxidase_C 4.8e-06 45.0 20/249  
:HMM:PFM   304->319 PF12579 * DUF3755 0.00024 37.5 16/35  
:BLT:SWISS 27->419 GLCE_ECOLI 3e-26 30.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21098.1 GT:GENE glcE GT:PRODUCT (S)-2-hydroxy-acid oxidase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(279711..280979) GB:FROM 279711 GB:TO 280979 GB:DIRECTION - GB:GENE glcE GB:PRODUCT (S)-2-hydroxy-acid oxidase GB:NOTE GlcE GB:PROTEIN_ID AAZ21098.1 GB:DB_XREF GI:71062095 GB:GENE:GENE glcE LENGTH 422 SQ:AASEQ MKKNSQIFQDSNNTYYPEDELQVSNLVQELYKKNQPTEIIGTGSKNFIGNNIQSAKKLSMSKLSGVIEYLPEELYIKVKANTPLELVEKELEKNNQELAFEPIDFGFIENGKSNKGTIAGHLACNFAGSRRFKVGSLRDHILGFRGVNGKGDIIKSGGTVVKNVTGYDLSKLVTGSFGTLVALTEITLKVLPKKKLSNTITIHTDDKKLVKNLFDKISSSSSEVSGAVYIPEEPKDENYDQNKEMVFKFNDLKYKGSFLALRIEGDKIAIDEKIKALTNELELSKLNTTVLDVHQSTPFWKKINNLELFKQTKNNLLRVVVPPSKGPKLIQFLGNKYKYYIDWCGSLYWIEVQSKKNSKVSDIKKLTKELGGYLTIIKTSDEYDYEETIFTVDDIRLLISEKIKKSFDPKRIFNPGKMYRGI GT:EXON 1|1-422:0| BL:SWS:NREP 1 BL:SWS:REP 27->419|GLCE_ECOLI|3e-26|30.1|332/350| SEG 84->98|lelvekeleknnqel| SEG 218->222|sssss| BL:PDB:NREP 1 BL:PDB:REP 17->190|2uuuC|7e-06|26.4|159/541| RP:PDB:NREP 1 RP:PDB:REP 16->420|1ahuA|4e-28|12.3|391/555| RP:PFM:NREP 1 RP:PFM:REP 17->157|PF01565|1e-07|24.8|133/139|FAD_binding_4| HM:PFM:NREP 3 HM:PFM:REP 15->155|PF01565|4.5e-18|29.5|132/138|FAD_binding_4| HM:PFM:REP 399->418|PF02913|4.8e-06|45.0|20/249|FAD-oxidase_C| HM:PFM:REP 304->319|PF12579|0.00024|37.5|16/35|DUF3755| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01565|IPR006094| GO:PFM GO:0050660|"GO:FAD binding"|PF01565|IPR006094| RP:SCP:NREP 2 RP:SCP:REP 15->193|1fiqB2|1e-18|8.3|168/191|d.145.1.3| RP:SCP:REP 317->420|1f0xA1|3e-09|11.7|94/237|d.58.32.2| HM:SCP:REP 15->194|1e8gA2|4.4e-30|28.8|170/0|d.145.1.1|1/1|FAD-binding domain| HM:SCP:REP 249->421|1e8gA1|5e-18|23.1|173/0|d.58.32.1|1/1|FAD-linked oxidases, C-terminal domain| OP:NHOMO 652 OP:NHOMOORG 455 OP:PATTERN -------1-11111-1--221112------------------------12111----------1---- --112---------11111-1111212222211111-331-1-1----------------111-133------------1-11111----------------1---------------------------------33312----11111111111111-11111111111---------------11---11111111111111111133111111122213--------2------------------------1-------11--11------------------------------------------------------2--2-----1-2-2-1221---2--1-1--2-231111--22--1--1-121---1-----11211111212221111111-111-11111211122-11111131112221---11211112221111111121121-12-----------------------------1--4--111114333342222233452222223342222-122233222223224112211--2-------222332-1411213222222-212112212111121-31--1111111111111111111-1122----2----------------------------2112-------------1---1-1111--111111111-1111111--------------------------------------------------1---------2-211----------------------1111-11111111112121111------------------------11111111111111--1-111111----------1--------------------------11---1---2-- ----22-------1-------1-1-11------------------------11----1-111------11-2-1----1-1---1-----------------------2----------------------------------------------------------------------------3--4-3---22321 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 407 STR:RPRED 96.4 SQ:SECSTR ##############EccccHHHHHHHHHHHHHHTccEEEEccccccTTTTTTccccTEEcTTTccEEEEETTTTEEEEcTTccHHHHHHHHHTTTGGGTEEcTTEEEccccccccccccHHHHHHHTcccccTTccTGGGEEEEEEEcTTccEEETTTccTTTcccccGccGGGGccccccEEEEEEEEcEEccccEEEEEEEEccTTHHHHHHHHHHHHHHHTcccTTTccccccccHHHHHHHHHHHHHHTcccEEEEEEEEccHHHHHHHHHHHHHHGGGcTTcEEEcGGcccccHHHGGGGcccccEEEEEccEEcccHHHHHHHHHHHHHHTTcccccEEEEcccHHHHHHHHHHHHHHHHHHHTTcccccccGHHHHHHHccHHHHHHHHHHHcHHHHHHHcTTccccTTGGGcH# DISOP:02AL 1-3| PSIPRED ccccccccccccEEEEcccHHHHHHHHHHHHHcccEEEEEEccccccccccccccEEEEHHHHcccEEEEccccEEEEEccccHHHHHHHHHHcccEEccccccccccccccccccEEEcccccccccccccccccHHHHEEEEEEEcccccEEEcccccccccccccHHHHHHcccccEEEEEEEEEEEEEcccEEEEEEEEEccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHcccccEEEEcHHHHHHHHHHHHHHHHHccccccEEEEEEEHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccc //