[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : gmhA
DDBJ      :gmhA         phosphoheptose isomerase  NMA0340
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  375/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.80.1
:188 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->180 1x92B PDBj 1e-21 32.4 %
:RPS:PDB   36->181 3c3jE PDBj 2e-07 19.0 %
:RPS:SCOP  36->180 1tk9A  c.80.1.3 * 1e-26 30.6 %
:HMM:SCOP  1->186 1x92A_ c.80.1.3 * 1.1e-33 24.7 %
:HMM:PFM   104->158 PF01380 * SIS 3.9e-11 32.7 55/131  
:HMM:PFM   6->102 PF08925 * DUF1907 0.00078 10.4 96/284  
:BLT:SWISS 34->176 GMHA_DESVH 6e-22 34.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21366.1 GT:GENE gmhA GT:PRODUCT phosphoheptose isomerase NMA0340 GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 538166..538732 GB:FROM 538166 GB:TO 538732 GB:DIRECTION + GB:GENE gmhA GB:PRODUCT phosphoheptose isomerase NMA0340 GB:PROTEIN_ID AAZ21366.1 GB:DB_XREF GI:71062363 GB:GENE:GENE gmhA LENGTH 188 SQ:AASEQ MKDIILKDLNSKSHIINNLDIKKLIDISKIFKNAINNKRLFFTCGNGGSASTADHVACDYLKRFKKFKSAIRIISLSSNSSTLTAMGNDVNFNQIYSEQIQCLAKRGDILIIFSVSGNSKNLLEAAKISKKKGLKIISFTGNKGGKLFKLSNICINLNSKNYGLVEDIHLSLTHLLSDYILGKKNIIK GT:EXON 1|1-188:0| BL:SWS:NREP 1 BL:SWS:REP 34->176|GMHA_DESVH|6e-22|34.8|141/208| SEG 19->32|ldikklidiskifk| SEG 69->81|sairiislssnss| SEG 127->138|kiskkkglkiis| BL:PDB:NREP 1 BL:PDB:REP 33->180|1x92B|1e-21|32.4|148/197| RP:PDB:NREP 1 RP:PDB:REP 36->181|3c3jE|2e-07|19.0|126/360| HM:PFM:NREP 2 HM:PFM:REP 104->158|PF01380|3.9e-11|32.7|55/131|SIS| HM:PFM:REP 6->102|PF08925|0.00078|10.4|96/284|DUF1907| RP:SCP:NREP 1 RP:SCP:REP 36->180|1tk9A|1e-26|30.6|144/188|c.80.1.3| HM:SCP:REP 1->186|1x92A_|1.1e-33|24.7|182/0|c.80.1.3|1/1|SIS domain| OP:NHOMO 508 OP:NHOMOORG 380 OP:PATTERN -----------------------------------111------------------------11---- 112------------2111-1-----11111-----1------------11-11------11---1-----------------11111--1--------------11-------------------111-----1122222-111--1-1111-----------1------1-1-21-----------111--------------------------------------------------------------------------------------11-----------------------------------------------1--------1------------------1-------------1----11-------------231112-12--------------------1-11----------1--1-----1--------------------1211-----------------------------1---1-11111-------1111--1111111---1122111----1----112--11112-2211111111-11111-21--1111121111111111111-----1111111-2221211111111112111-221111111-1121111111111111111111--1111----11122122222222222222-2222222222222222222222222322222222222222222222222221-222222222232--211111111111131-111111111111111----------1-11111111211111111111111111121112222222222--------------------1122----------------------------------------------111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 156 STR:RPRED 83.0 SQ:SECSTR ################################THHTTcEEEEEEccTHHHHHHHHHHHHHHHHHHcTcEEccGGGccccTTcEEEEccHHHHHHHHHcGGTccTTccEEEEEEEcccccHHHHHHHHHHHcccEEEccEEccTTcHHHHHHHHcTTcccEEcGGGcccccccHHHHHHHHHHHHHHHc DISOP:02AL 188-189| PSIPRED cHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHccccHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHcccEEEEEEccccccHHHHccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHcccc //