[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : grlA
DDBJ      :grlA         Glutaredoxin
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  467/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:110 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->107 2wemC PDBj 4e-25 56.0 %
:RPS:PDB   10->106 2ct6A PDBj 2e-16 15.5 %
:RPS:SCOP  3->105 1wikA  c.47.1.1 * 1e-17 39.8 %
:HMM:SCOP  2->110 1wikA_ c.47.1.1 * 1.1e-30 41.3 %
:RPS:PFM   29->82 PF00462 * Glutaredoxin 1e-10 44.4 %
:HMM:PFM   18->82 PF00462 * Glutaredoxin 2.9e-19 41.7 60/60  
:BLT:SWISS 1->104 GLRX2_RICTY 7e-31 56.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21946.1 GT:GENE grlA GT:PRODUCT Glutaredoxin GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1096970..1097302 GB:FROM 1096970 GB:TO 1097302 GB:DIRECTION + GB:GENE grlA GB:PRODUCT Glutaredoxin GB:PROTEIN_ID AAZ21946.1 GB:DB_XREF GI:71062943 GB:GENE:GENE grlA LENGTH 110 SQ:AASEQ MDDSTKNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREGIKEFSDWPTIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKGINFKK GT:EXON 1|1-110:0| BL:SWS:NREP 1 BL:SWS:REP 1->104|GLRX2_RICTY|7e-31|56.7|104/111| BL:PDB:NREP 1 BL:PDB:REP 24->107|2wemC|4e-25|56.0|84/109| RP:PDB:NREP 1 RP:PDB:REP 10->106|2ct6A|2e-16|15.5|97/111| RP:PFM:NREP 1 RP:PFM:REP 29->82|PF00462|1e-10|44.4|54/60|Glutaredoxin| HM:PFM:NREP 1 HM:PFM:REP 18->82|PF00462|2.9e-19|41.7|60/60|Glutaredoxin| GO:PFM:NREP 3 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00462|IPR002109| GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF00462|IPR002109| GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF00462|IPR002109| RP:SCP:NREP 1 RP:SCP:REP 3->105|1wikA|1e-17|39.8|103/109|c.47.1.1| HM:SCP:REP 2->110|1wikA_|1.1e-30|41.3|109/0|c.47.1.1|1/1|Thioredoxin-like| OP:NHOMO 1000 OP:NHOMOORG 667 OP:PATTERN ------------------------11111111------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111221111111111111111111-1111111111111111111111112211111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111---------------------------12---------------------------111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111211111111111111211111111111111111111111111122222222222222111-111111------------------------------------------------- 3311222-93312231222222222222222222222212221222122233221222222221222222341223322322222222-232222232222223221281412222-21-2221222423C2-235111-22222211-122222232233422222222723532435T4444485A62453342233 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 109 STR:RPRED 99.1 SQ:SECSTR cccHHHHHHccccccccEEEEEcccccHHHHHHHHHHHHHHHHTTccEEEEETTTcHHHHHTTccccccccccEEEETTEEEEEHHHHHHHHTTTcHHHHHTcccccHc# DISOP:02AL 1-3, 107-110| PSIPRED ccHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHccccccEEEEccEEEccHHHHHHHHHcccHHHHHHHHcccccc //