[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : gshB
DDBJ      :gshB         glutathione synthase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  432/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.30.1d.142.1
:309 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->289 1gsaA PDBj 8e-37 32.8 %
:RPS:PDB   1->305 1bxrA PDBj 2e-07 8.5 %
:RPS:SCOP  6->122 1glvA1  c.30.1.3 * 3e-13 30.8 %
:RPS:SCOP  124->305 1glvA2  d.142.1.1 * 7e-06 26.8 %
:HMM:SCOP  6->123 1gsaA1 c.30.1.3 * 1.5e-29 32.2 %
:HMM:SCOP  124->307 1gsaA2 d.142.1.1 * 1.1e-36 28.4 %
:RPS:PFM   21->105 PF02951 * GSH-S_N 9e-15 36.5 %
:RPS:PFM   125->289 PF02955 * GSH-S_ATP 2e-23 31.7 %
:HMM:PFM   125->295 PF02955 * GSH-S_ATP 3.7e-48 35.3 170/176  
:HMM:PFM   6->121 PF02951 * GSH-S_N 2e-31 30.2 116/119  
:BLT:SWISS 4->308 GSHB_AGRT5 1e-44 32.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21516.1 GT:GENE gshB GT:PRODUCT glutathione synthase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(680622..681551) GB:FROM 680622 GB:TO 681551 GB:DIRECTION - GB:GENE gshB GB:PRODUCT glutathione synthase GB:PROTEIN_ID AAZ21516.1 GB:DB_XREF GI:71062513 GB:GENE:GENE gshB LENGTH 309 SQ:AASEQ MTNKIVAIQGDHPSKLKPLTDTSIFLAIEAQRLKYKIFYYEPKDLSIINDKVVANGFYVEFNYSNKRYFKILNQQKLELTQCKYILIRQDPPFNLEYISTTYILDKIKNKVKIINNPTSIRNISEKLYSTSFQKYMPDTIFTKDINEINKFFSKNKKMIIKPIHSFSGNDIHLFQNKINKKLIINFIKKHGHIMCQKFLPKIKFGDKRVFIINGKVCGAISRVPKKGSFLSNMSKGAIPISAKLTKLENKISNIIGKDLKKNDIYFSGIDFIDQKLNGDINVTSPTGLKSFYDLTSINLAKTFWKGLKA GT:EXON 1|1-309:0| BL:SWS:NREP 1 BL:SWS:REP 4->308|GSHB_AGRT5|1e-44|32.1|302/319| SEG 106->116|kiknkvkiinn| SEG 176->189|nkinkkliinfikk| BL:PDB:NREP 1 BL:PDB:REP 21->289|1gsaA|8e-37|32.8|268/314| RP:PDB:NREP 1 RP:PDB:REP 1->305|1bxrA|2e-07|8.5|295/1073| RP:PFM:NREP 2 RP:PFM:REP 21->105|PF02951|9e-15|36.5|85/119|GSH-S_N| RP:PFM:REP 125->289|PF02955|2e-23|31.7|164/176|GSH-S_ATP| HM:PFM:NREP 2 HM:PFM:REP 125->295|PF02955|3.7e-48|35.3|170/176|GSH-S_ATP| HM:PFM:REP 6->121|PF02951|2e-31|30.2|116/119|GSH-S_N| GO:PFM:NREP 5 GO:PFM GO:0004363|"GO:glutathione synthase activity"|PF02951|IPR004215| GO:PFM GO:0006750|"GO:glutathione biosynthetic process"|PF02951|IPR004215| GO:PFM GO:0004363|"GO:glutathione synthase activity"|PF02955|IPR004218| GO:PFM GO:0005524|"GO:ATP binding"|PF02955|IPR004218| GO:PFM GO:0006750|"GO:glutathione biosynthetic process"|PF02955|IPR004218| RP:SCP:NREP 2 RP:SCP:REP 6->122|1glvA1|3e-13|30.8|117/122|c.30.1.3| RP:SCP:REP 124->305|1glvA2|7e-06|26.8|168/177|d.142.1.1| HM:SCP:REP 6->123|1gsaA1|1.5e-29|32.2|118/0|c.30.1.3|1/1|PreATP-grasp domain| HM:SCP:REP 124->307|1gsaA2|1.1e-36|28.4|183/192|d.142.1.1|1/1|Glutathione synthetase ATP-binding domain-like| OP:NHOMO 447 OP:NHOMOORG 435 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1-----------------------------------------------------------11-------------------------1----1----------1111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-11111111111112211111111111111111111111111111111111111111111111111---------------1111111111111111111111111111111111111111111-1111111111111111111111111111111111111----------------------------11---------------------------111111111111111111112111121221121-1-11111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111--1111111111111111---------------1111111111111111111111111111111111111121112111111112211111111111111111-------------------------------------------------------- ---------------1---------------------------------------------------------------------------------------------------------------------------------------------------2------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 305 STR:RPRED 98.7 SQ:SECSTR cccccEEEEEccccccTTccHHHHHHHHHHHHTTcEEEEEEccTTccTTcccTTTccEEEEccccHHHHHHHETTEHHHHcccEEEccccTHHHHHHHHHHHHTTccEEcccccccHHHHHHHHcHHHHHHHHHHcccEEEEccHHHHHHHHHHHccEEEEcccccTTTTcEEEHHHHHHHHHHHHHcTTccEEEEEccTTcEEEEEEEEEccccEEEEEEEEEcccTTccGGGccEEEccccccHHHHHHHHHHHHHHHHHTccEEEEEEEEEETTEEEEccccTTHHHHHHHHTccHHHHHHH#### DISOP:02AL 1-2| PSIPRED ccccEEEEEEccHHHcccccHHHHHHHHHHHHcccEEEEEEcccEEEEccEEEEEEEEEEEEcccccEEEEccccccccccccEEEEccccccccHHHHHHHHHHHHHcccEEEccHHHHHHHHHHHHHHHHHHHccccEEEccHHHHHHHHHHcccEEEEEcccccccEEEEEccHHHHHHHHHHHHccccEEEEEEccccccccEEEEEEccEEEEEEEEEcccccEEEEEEcccEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEEEccEEEEEEEEcccHHHHHHHHHHcccHHHHHHHHHcc //