[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : gutQ
DDBJ      :gutQ         Arabinose 5-phosphate isomerase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  534/915 : Eukaryota  35/199 : Viruses  1/175   --->[See Alignment]
c.80.1d.37.1
:323 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->137 3fxaC PDBj 1e-12 28.9 %
:BLT:PDB   204->297 3fnaB PDBj 4e-07 38.8 %
:RPS:PDB   17->304 2cb0A PDBj 4e-20 13.5 %
:RPS:SCOP  10->297 1b0zA  c.80.1.2 * 9e-18 13.0 %
:HMM:SCOP  4->252 1moqA_ c.80.1.1 * 2.2e-50 28.8 %
:HMM:SCOP  259->319 1pbjA2 d.37.1.1 * 1.9e-08 34.5 %
:HMM:PFM   42->170 PF01380 * SIS 2.8e-25 30.7 127/131  
:HMM:PFM   198->252 PF00571 * CBS 1.6e-07 24.5 53/57  
:HMM:PFM   265->318 PF00571 * CBS 4e-08 27.5 51/57  
:BLT:SWISS 1->305 Y1546_AQUAE 4e-53 39.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21319.1 GT:GENE gutQ GT:PRODUCT Arabinose 5-phosphate isomerase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(485035..486006) GB:FROM 485035 GB:TO 486006 GB:DIRECTION - GB:GENE gutQ GB:PRODUCT Arabinose 5-phosphate isomerase GB:PROTEIN_ID AAZ21319.1 GB:DB_XREF GI:71062316 GB:GENE:GENE gutQ LENGTH 323 SQ:AASEQ MKKRNYKKIAKSVIDLEIKALKKLKDSINNSFNEAVESLANCQSKVILCGVGKSGLIAAKISATLSSVGTPSFSLSANDCSHGDLGSISKKDILILISYSGSTEELKNIIKYANRNKITLIGIMSKKNSILYKASDIKLLIPEVTEAGLGIVPTSSTINQLSIGDALAVAVLNKKNINKKDFKKFHPSGNLGAQLRTVEELMITGKKIPFVNESLNMKKALQIISNKKLGTLIVQNNKKITTGIITDGQIRRVNAMSNNLQDLSVKKVMTKNPISINLDTLAEKALSIMNAKKITSLCVHKDKNKKKTIGILHIHNILHSNIR GT:EXON 1|1-323:0| BL:SWS:NREP 1 BL:SWS:REP 1->305|Y1546_AQUAE|4e-53|39.0|305/322| SEG 87->100|siskkdililisys| SEG 173->185|nkkninkkdfkkf| SEG 309->322|igilhihnilhsni| BL:PDB:NREP 2 BL:PDB:REP 17->137|3fxaC|1e-12|28.9|121/187| BL:PDB:REP 204->297|3fnaB|4e-07|38.8|85/114| RP:PDB:NREP 1 RP:PDB:REP 17->304|2cb0A|4e-20|13.5|274/313| HM:PFM:NREP 3 HM:PFM:REP 42->170|PF01380|2.8e-25|30.7|127/131|SIS| HM:PFM:REP 198->252|PF00571|1.6e-07|24.5|53/57|CBS| HM:PFM:REP 265->318|PF00571|4e-08|27.5|51/57|CBS| RP:SCP:NREP 1 RP:SCP:REP 10->297|1b0zA|9e-18|13.0|284/442|c.80.1.2| HM:SCP:REP 4->252|1moqA_|2.2e-50|28.8|243/0|c.80.1.1|1/1|SIS domain| HM:SCP:REP 259->319|1pbjA2|1.9e-08|34.5|58/61|d.37.1.1|2/2|CBS-domain| OP:NHOMO 689 OP:NHOMOORG 570 OP:PATTERN -------------------------------------------------------------------- 111--------------------------------------------------------------------------------11111---1-111---111111111-111111111111111111111111111----------1--1-----11111-11-------1-1-----1-----------1----------------------------------11111---------------------------------------1----11---------------------------------------------------------------2-------1--------------1--------11111111111111--1111111111111111111111-1111111111111111111111331111111111111111111111111111111------------1111111111111----1-12-111111211112111111121222222211211211111111111111111111111111111111---11111111111--1211111111111111111-11111111111111111-11111111111112111111111111111111111111111--11111------21111212224244422-2222434222243322332222111112222222222222222331222221122222222222211111111111111111111211111111111111111111111111111111121221111111111111112111111111211111111111111111111111111------------------------------------------1---111 ---------------1111111-1111-------1-----------11--1111-1--1---------------------1-----------1---------11------------------------------------------------------------------1--1---------1121-3111--1---- ---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 300 STR:RPRED 92.9 SQ:SECSTR ######EEGcccHHHTHHTTHHHHHHHHHHHHHHHTTTccccccEEEEEEcTHHHHHHHHHHHHHTHTTcEEEEEEHHHHHHHGGGcccccccEEEEEcccccHHHHHHHHTccccEEEEEccccHcccHHHHTccEEEEccccccccccccccHHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHTTHHHHHHHHHHccccEEEEETHHHHHHHHHHHHHHcccEEEEEGGGGGTTGGGGccTTEEEEEEccccHHHHHHHHHHHHTTcEEEEEEEEEcccccccccEEEEcccccTTTTcc################# DISOP:02AL 1-3, 183-193| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHccccEEEEEcccccccHHHcEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEEHHHHHHHHHHccccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEEccccEEEEEEEEHHHHHHHccc //