[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : hesB
DDBJ      :hesB         hesB protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  588/915 : Eukaryota  182/199 : Viruses  0/175   --->[See Alignment]
b.124.1
:110 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->110 2apnA PDBj 7e-20 34.9 %
:RPS:PDB   3->110 2d2aA PDBj 4e-32 38.3 %
:RPS:SCOP  5->97 1r94A  b.124.1.1 * 6e-29 42.4 %
:HMM:SCOP  4->96 1nwbA_ b.124.1.1 * 3.1e-28 40.9 %
:RPS:PFM   5->96 PF01521 * Fe-S_biosyn 3e-18 43.5 %
:HMM:PFM   5->96 PF01521 * Fe-S_biosyn 7.1e-28 39.6 91/91  
:BLT:SWISS 1->110 Y484_RICPR 7e-30 47.3 %
:PROS 91->108|PS01152|HESB

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21564.1 GT:GENE hesB GT:PRODUCT hesB protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 728392..728724 GB:FROM 728392 GB:TO 728724 GB:DIRECTION + GB:GENE hesB GB:PRODUCT hesB protein GB:PROTEIN_ID AAZ21564.1 GB:DB_XREF GI:71062561 GB:GENE:GENE hesB LENGTH 110 SQ:AASEQ MNPIIKLSDNAASRIKEIMSGVESNSIGVRVAVKSGGCAGMSYVMEYAKEINLSDEIIEDKGVKVFVDAAAVMYLLGTEMDYKKEEFSSSFVFNNPNESERCGCGESFKV GT:EXON 1|1-110:0| BL:SWS:NREP 1 BL:SWS:REP 1->110|Y484_RICPR|7e-30|47.3|110/110| PROS 91->108|PS01152|HESB|PDOC00887| BL:PDB:NREP 1 BL:PDB:REP 5->110|2apnA|7e-20|34.9|106/114| RP:PDB:NREP 1 RP:PDB:REP 3->110|2d2aA|4e-32|38.3|107/114| RP:PFM:NREP 1 RP:PFM:REP 5->96|PF01521|3e-18|43.5|92/92|Fe-S_biosyn| HM:PFM:NREP 1 HM:PFM:REP 5->96|PF01521|7.1e-28|39.6|91/91|Fe-S_biosyn| RP:SCP:NREP 1 RP:SCP:REP 5->97|1r94A|6e-29|42.4|92/97|b.124.1.1| HM:SCP:REP 4->96|1nwbA_|3.1e-28|40.9|93/101|b.124.1.1|1/1|HesB-like domain| OP:NHOMO 1515 OP:NHOMOORG 777 OP:PATTERN ------------------------1--11-11----------------------------------11 111111111111-111111-1-111-111111-----111112211-1111111111111---111----1-----------112111-----------1-111111112--------------1---------1-11111---112333232111111111-1212433311111111111111111---1111111111111111111---111111111--1------211--------------11111--------------------------------------------------------------------------------------------------1---------------------1-1222222222333332223333322222222222-2232232223221222333222223322222233332222222222212212322-1111111112222222222222221111211122222222222222222222222222222442222222224222224232222322222222222222222331-----------------------222222---------------------------332222222222222222222222222222222--22222--11133232323333333333-333333333333322332333333333333333333333333333323333223333333333332222111112222422222222222222222222222222222322222222222222322222222222222222222222232222222222222222223-----------------------------------------------------42- 3---222-4---22211221122111111231-121-11111111111222222-1111111221111-1211211111111221121-1211211111121-333-2223122321-22222332122383-334321221222221112132333232122211-224313322232S2123375561433332222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 110 STR:RPRED 100.0 SQ:SECSTR cccccEEcHHHHHHHHHHHHHHcTTccEEEEEEEEETTTEEEEEEEEEccccTTEEEEEETTEEEEEEGGGHHHHTTcEEEEEEETTEEEEEEEcTTTcccccccccccc PSIPRED cccccEEcHHHHHHHHHHHHHcccccEEEEEEEEccccccEEEEEEEEcccccccEEEEEccEEEEEcHHHHHHHcccEEEEEEcccccEEEEEcccccccccccccccc //