[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : himA
DDBJ      :himA         Bacterial DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  551/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.55.1
:102 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->98 1owfA PDBj 2e-12 36.3 %
:RPS:PDB   8->97 3c4iB PDBj 1e-16 24.4 %
:RPS:SCOP  8->75 1b8zA  a.55.1.1 * 3e-11 28.4 %
:HMM:SCOP  8->97 1exeA_ a.55.1.1 * 1.4e-23 40.0 %
:RPS:PFM   8->96 PF00216 * Bac_DNA_binding 9e-13 46.1 %
:HMM:PFM   8->97 PF00216 * Bac_DNA_binding 7.7e-30 45.6 90/90  
:BLT:SWISS 8->99 IHFA_ANASK 8e-18 41.3 %
:PROS 53->72|PS00045|HISTONE_LIKE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21841.1 GT:GENE himA GT:PRODUCT Bacterial DNA-binding protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1009118..1009426) GB:FROM 1009118 GB:TO 1009426 GB:DIRECTION - GB:GENE himA GB:PRODUCT Bacterial DNA-binding protein GB:PROTEIN_ID AAZ21841.1 GB:DB_XREF GI:71062838 GB:GENE:GENE himA LENGTH 102 SQ:AASEQ MLMQRTNLTKKDLINSIYMQIGFSKNISENLIDDFLITIVDNLKIEKKLKLSKFGTFSIRAKKSRIGRNPKTKEQTTISNRDVVLFKASKEFKDLVNSKNDS GT:EXON 1|1-102:0| BL:SWS:NREP 1 BL:SWS:REP 8->99|IHFA_ANASK|8e-18|41.3|92/113| PROS 53->72|PS00045|HISTONE_LIKE|PDOC00044| BL:PDB:NREP 1 BL:PDB:REP 8->98|1owfA|2e-12|36.3|91/96| RP:PDB:NREP 1 RP:PDB:REP 8->97|3c4iB|1e-16|24.4|90/97| RP:PFM:NREP 1 RP:PFM:REP 8->96|PF00216|9e-13|46.1|89/90|Bac_DNA_binding| HM:PFM:NREP 1 HM:PFM:REP 8->97|PF00216|7.7e-30|45.6|90/90|Bac_DNA_binding| GO:PFM:NREP 1 GO:PFM GO:0003677|"GO:DNA binding"|PF00216|IPR000119| RP:SCP:NREP 1 RP:SCP:REP 8->75|1b8zA|3e-11|28.4|67/67|a.55.1.1| HM:SCP:REP 8->97|1exeA_|1.4e-23|40.0|90/99|a.55.1.1|1/1|IHF-like DNA-binding proteins| OP:NHOMO 673 OP:NHOMOORG 553 OP:PATTERN -------------------------------------------------------------------- 111---------------------------------------------------------------------------------1-12---1-1---------1---------------------11211111322----------31--22-----111--11------------11----1---11----111111121121112211111111221111111-------2-11111111111111-111-------------------11---111--------------------------------------------2--1111111111112-111---1-111-11-1--1-1111-111121--11-111121111311111111111111111111111-111112112111322111111111211111111111111111111111111231111-11111------11---------11112212311111-1111111111111121111111211121111111-111111111111122211111111111111222113212211112112152222511111121-------------------------22112111111111111122211112122122--22211--1---11111121111111-11-1111111111111111111111112211111111111111111111111111-111111111111--4111111----11111111-112111112212222222222211111111111111111111111111122221222222222211111111111111115--------------------------1----------------------------1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----1----------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 92.2 SQ:SECSTR ####cccccHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHTTccEEETTTEEEEEEEEccEEEEcTTTccEEEEccEEEEEEEEcHHHHHHHHT#### DISOP:02AL 1-6, 65-69, 94-95, 98-102| PSIPRED cccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEcccEEEEEEEcccccccccccccEEEEccccEEEEcccHHHHHHHcccccc //