[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : himD
DDBJ      :himD         Integration host factor beta-subunit (IHF-beta)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  493/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.55.1
:96 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->93 1ihfB PDBj 2e-14 37.4 %
:RPS:PDB   5->94 3c4iB PDBj 4e-15 24.7 %
:RPS:SCOP  5->71 1b8zA  a.55.1.1 * 1e-10 32.3 %
:HMM:SCOP  3->96 1ihfB_ a.55.1.1 * 1.9e-22 43.6 %
:RPS:PFM   3->88 PF00216 * Bac_DNA_binding 6e-12 42.4 %
:HMM:PFM   5->93 PF00216 * Bac_DNA_binding 2.2e-29 47.7 88/90  
:BLT:SWISS 3->94 IHFB_METSB 2e-21 48.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21313.1 GT:GENE himD GT:PRODUCT Integration host factor beta-subunit (IHF-beta) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(479666..479956) GB:FROM 479666 GB:TO 479956 GB:DIRECTION - GB:GENE himD GB:PRODUCT Integration host factor beta-subunit (IHF-beta) GB:PROTEIN_ID AAZ21313.1 GB:DB_XREF GI:71062310 GB:GENE:GENE himD LENGTH 96 SQ:AASEQ MAIVKSKLLKQLANNYPNFLKKDLEKFTDIILTEIKQALKRGDRVELRGFGMFSTNIQKARISRNPKTGEKVNTPEKKTIHFKMSKEMFKKLNNDE GT:EXON 1|1-96:0| BL:SWS:NREP 1 BL:SWS:REP 3->94|IHFB_METSB|2e-21|48.9|92/96| BL:PDB:NREP 1 BL:PDB:REP 3->93|1ihfB|2e-14|37.4|91/94| RP:PDB:NREP 1 RP:PDB:REP 5->94|3c4iB|4e-15|24.7|89/97| RP:PFM:NREP 1 RP:PFM:REP 3->88|PF00216|6e-12|42.4|85/90|Bac_DNA_binding| HM:PFM:NREP 1 HM:PFM:REP 5->93|PF00216|2.2e-29|47.7|88/90|Bac_DNA_binding| GO:PFM:NREP 1 GO:PFM GO:0003677|"GO:DNA binding"|PF00216|IPR000119| RP:SCP:NREP 1 RP:SCP:REP 5->71|1b8zA|1e-10|32.3|65/67|a.55.1.1| HM:SCP:REP 3->96|1ihfB_|1.9e-22|43.6|94/94|a.55.1.1|1/1|IHF-like DNA-binding proteins| OP:NHOMO 673 OP:NHOMOORG 493 OP:PATTERN -------------------------------------------------------------------- 222--------------------------------------------------------------------------------112-11--------------1---------------------11211111211--------------------------------------------------------11111111111111122111111111111-1---------2---------------------------------11--1--------------------------------------------------------111111111111-111111--1--1---1--1111--1111111--11-111111111211111111111111111111111-1141222311111111111111111111111111111111111111111112111----------11----------------121121111111222222222222222212222222223111222--1111-1-1111412111122222221112142---111212111--222-2323211112112-------------------------11211111221111111111111111111111--121111-111122221222222222-21-2222222222222222222222221112222222222222222222222222-111111111111--111111111111111111121111111211122222221111111111-11111111111---------12222333333322211111111111111--3---------------------------------------------1-1-----1-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 99.0 SQ:SECSTR #cccHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHTTccEEETTTEEEEEEEEccEEEEcTTTccEEEEccEEEEEEEEcHHHHHHHHTcc DISOP:02AL 94-96| PSIPRED ccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccEEEEcEEEEEEEEcccccccccccccEEEEccccEEEEcccHHHHHHHcccc //