[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : hisA
DDBJ      :hisA         phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase
Swiss-Prot:HIS4_PELUB   RecName: Full=1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase;         EC=5.3.1.16;AltName: Full=Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase;

Homologs  Archaea  55/68 : Bacteria  714/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:239 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->235 2vepA PDBj 1e-27 31.0 %
:RPS:PDB   1->237 2cffA PDBj 2e-20 27.7 %
:RPS:SCOP  3->232 1qo2A  c.1.2.1 * 3e-57 28.9 %
:HMM:SCOP  1->238 1qo2A_ c.1.2.1 * 2e-67 40.7 %
:RPS:PFM   2->228 PF00977 * His_biosynth 4e-31 31.6 %
:HMM:PFM   2->228 PF00977 * His_biosynth 2.1e-77 40.3 226/228  
:BLT:SWISS 1->239 HIS4_PELUB e-128 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21153.1 GT:GENE hisA GT:PRODUCT phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(326112..326831) GB:FROM 326112 GB:TO 326831 GB:DIRECTION - GB:GENE hisA GB:PRODUCT phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase GB:PROTEIN_ID AAZ21153.1 GB:DB_XREF GI:71062150 GB:GENE:GENE hisA LENGTH 239 SQ:AASEQ MKIFPAIDIKDKKCVRLIKGDFNNKTEYEISPVDQAGKYKDHGFKNLHIVDLDGALTGETVNLDIIKEIVHKFDLKIEVGGGVRSIDSIEKYINAGVEKVILGSAAIKNKNFLKEACQKFPNKIALGLDAKDGYLSVSGWKENSNQLTLDFLKEVNDYGASRLIYTDINRDGTKESPNFEETTNVANVSNCPVIISGGVSSIDDIKKAKGLKNIEGIIVGKAIYDGDIKLEELVKELDA GT:EXON 1|1-239:0| SW:ID HIS4_PELUB SW:DE RecName: Full=1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC=5.3.1.16;AltName: Full=Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; SW:GN Name=hisA; OrderedLocusNames=SAR11_0330; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Histidine biosynthesis; Isomerase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->239|HIS4_PELUB|e-128|100.0|239/239| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| SEG 193->205|viisggvssiddi| BL:PDB:NREP 1 BL:PDB:REP 1->235|2vepA|1e-27|31.0|232/240| RP:PDB:NREP 1 RP:PDB:REP 1->237|2cffA|2e-20|27.7|235/241| RP:PFM:NREP 1 RP:PFM:REP 2->228|PF00977|4e-31|31.6|225/229|His_biosynth| HM:PFM:NREP 1 HM:PFM:REP 2->228|PF00977|2.1e-77|40.3|226/228|His_biosynth| GO:PFM:NREP 1 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF00977|IPR006062| RP:SCP:NREP 1 RP:SCP:REP 3->232|1qo2A|3e-57|28.9|228/241|c.1.2.1| HM:SCP:REP 1->238|1qo2A_|2e-67|40.7|236/0|c.1.2.1|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 1527 OP:NHOMOORG 773 OP:PATTERN ---2--2222222222-2222222222222222223314333322222322222-2-222-2----22 1121112222222222222-22222122222221112222222122212222222222--121121222222222222--22222222222222-----2-222222222---------------212122223222222233322222322222222223222222222222222223233222222222222222222222222222222222222222122222222221-22222222222222222-2----11-2---22--11----2-222-------222------------------------2----2----22-2222222-2-2222222---2-2--2212222222222222222--22222222-----222222322222222222222222122222222222-2222222222222222222212121322222222222222222-----------------------------222122222222222222222222222222222222222222222222222212223222122222222222222221322-222222222-2223222222222123342222233333-2-------22222222222222222221111112111111111112--222212211122222212222222222-2222222222222222222222223322222222222222222222222221-22222221222212-2-----333322321222222-2221---2222222222222323222222222222222--------222222222222223112222222122222232223322--------------------------------------2--2-222221 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-1---------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 239 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEETTEEEEEGGGcTTcEEEEcccHHHHHHHHHHHTcccEEEEEHHHHHHcccTTHHHHHHHHGGGGGGEEEEcccccHHHHHHHHHHTccEEEEcHHHHHcTTHHHHTTTTTcEEEEEEEEEETTEEccccHHHHHHccHHHHHHHHHTTTccEEEEEETTTccccccccHHHHHHHHHHHTcEEEEEcccccHHHHHHHHTTTcEEEEEEcHHHHHTcccHHHHHHTcHH PSIPRED cEEEEEEEEEccEEEEEEccccccccEEcccHHHHHHHHHHccccEEEEEEccHHHcccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEcHHHHHcHHHHHHHHHHccccEEEEEEEcccEEEEEcccccccccHHHHHHHHHHccccEEEEcccccHHccccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHccccEEEEEHHHHcccccHHHHHHHHHc //