[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : hisE
DDBJ      :hisE         phosphoribosyl-ATP diphosphatase with Escherichia coli pyrophosphohydrolase MazG domain
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.204.1
:101 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   5->89 2a7wA PDBj 1e-10 26.2 %
:RPS:SCOP  5->89 1yvwA1  a.204.1.4 * 1e-12 35.3 %
:HMM:SCOP  3->91 2a7wA1 a.204.1.4 * 2.4e-19 38.2 %
:RPS:PFM   14->89 PF01503 * PRA-PH 1e-04 43.2 %
:HMM:PFM   11->87 PF01503 * PRA-PH 1.4e-13 25.0 72/83  
:BLT:SWISS 4->101 HIS2_RHIE6 3e-14 37.8 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21151.1 GT:GENE hisE GT:PRODUCT phosphoribosyl-ATP diphosphatase with Escherichia coli pyrophosphohydrolase MazG domain GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(325056..325361) GB:FROM 325056 GB:TO 325361 GB:DIRECTION - GB:GENE hisE GB:PRODUCT phosphoribosyl-ATP diphosphatase with Escherichia coli pyrophosphohydrolase MazG domain GB:PROTEIN_ID AAZ21151.1 GB:DB_XREF GI:71062148 GB:GENE:GENE hisE LENGTH 101 SQ:AASEQ MSENLLNLVNTIRDRKNKDEDKSYTSSLLSGGLSKCIDKMEEEFDELKEALNDKSNIVHEAADTIYHILVTLEAADIKFEDVLKELEGRKKQSGIEEKNNR GT:EXON 1|1-101:0| BL:SWS:NREP 1 BL:SWS:REP 4->101|HIS2_RHIE6|3e-14|37.8|98/107| COIL:NAA 24 COIL:NSEG 1 COIL:REGION 37->60| SEG 26->34|ssllsggls| RP:PDB:NREP 1 RP:PDB:REP 5->89|2a7wA|1e-10|26.2|84/88| RP:PFM:NREP 1 RP:PFM:REP 14->89|PF01503|1e-04|43.2|74/85|PRA-PH| HM:PFM:NREP 1 HM:PFM:REP 11->87|PF01503|1.4e-13|25.0|72/83|PRA-PH| GO:PFM:NREP 2 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF01503|IPR008179| GO:PFM GO:0004636|"GO:phosphoribosyl-ATP diphosphatase activity"|PF01503|IPR008179| RP:SCP:NREP 1 RP:SCP:REP 5->89|1yvwA1|1e-12|35.3|85/92|a.204.1.4| HM:SCP:REP 3->91|2a7wA1|2.4e-19|38.2|89/0|a.204.1.4|1/1|all-alpha NTP pyrophosphatases| OP:NHOMO 51 OP:NHOMOORG 51 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------1--1111111111--------------1--1111111-11------1111-1----------------1------------------------------111----------------------------------------------------1----1---111111111---1--------------------------------1-----------1-------1--1111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 92.1 SQ:SECSTR ####HHHHHHHHHHGGGccTTTcHHHHHHHHcHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHcHHHccccc#### DISOP:02AL 92-101| PSIPRED ccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHccc //