[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : hpaG
DDBJ      :hpaG         fumarylacetoacetate hydrolase family protein
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  530/915 : Eukaryota  174/199 : Viruses  0/175   --->[See Alignment]
d.177.1
:281 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   71->238 1gttA PDBj 2e-26 35.0 %
:RPS:PDB   70->281 2dfuA PDBj 1e-55 28.4 %
:RPS:SCOP  70->281 1gttA1  d.177.1.1 * 6e-54 25.3 %
:HMM:SCOP  58->281 1hyoA2 d.177.1.1 * 8.5e-73 44.1 %
:RPS:PFM   77->278 PF01557 * FAA_hydrolase 3e-39 43.2 %
:HMM:PFM   73->277 PF01557 * FAA_hydrolase 2.8e-66 45.8 203/217  
:BLT:SWISS 1->273 UGL_BURCM 6e-68 46.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21597.1 GT:GENE hpaG GT:PRODUCT fumarylacetoacetate hydrolase family protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 755889..756734 GB:FROM 755889 GB:TO 756734 GB:DIRECTION + GB:GENE hpaG GB:PRODUCT fumarylacetoacetate hydrolase family protein GB:PROTEIN_ID AAZ21597.1 GB:DB_XREF GI:71062594 GB:GENE:GENE hpaG LENGTH 281 SQ:AASEQ MKFLRIGKAGQEIPVALDRNGKYRNLSSIIKDLNSETINFETLDKIKDINLENLEEVNQNERIGSCISKPGNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFVIGKKAKRVLEKDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYLVTKDEIQDVNNLNLTLDVNGHRHQTGNTNQMIFNFNFLVAHITSFITLMPGDIVTTGTPPGVGLGMDPPVFLKEGDEMKLNIDSLGSQNSKVILEQ GT:EXON 1|1-281:0| BL:SWS:NREP 1 BL:SWS:REP 1->273|UGL_BURCM|6e-68|46.2|273/282| SEG 50->61|nlenleevnqne| SEG 193->204|dvnnlnltldvn| SEG 239->248|vttgtppgvg| BL:PDB:NREP 1 BL:PDB:REP 71->238|1gttA|2e-26|35.0|160/421| RP:PDB:NREP 1 RP:PDB:REP 70->281|2dfuA|1e-55|28.4|201/251| RP:PFM:NREP 1 RP:PFM:REP 77->278|PF01557|3e-39|43.2|199/213|FAA_hydrolase| HM:PFM:NREP 1 HM:PFM:REP 73->277|PF01557|2.8e-66|45.8|203/217|FAA_hydrolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01557|IPR002529| GO:PFM GO:0008152|"GO:metabolic process"|PF01557|IPR002529| RP:SCP:NREP 1 RP:SCP:REP 70->281|1gttA1|6e-54|25.3|198/213|d.177.1.1| HM:SCP:REP 58->281|1hyoA2|8.5e-73|44.1|222/0|d.177.1.1|1/1|FAH| OP:NHOMO 1775 OP:NHOMOORG 760 OP:PATTERN 11---12222222221-112111221122143-1111111111-----111111111-1112211-11 2221431222221253222-2111352222212343329A221525211222785233--113122435211111111----5-1---11111111---11221231213------------------------111-12211123-111111----------1111111--------1----2222211-31122222222422322233111122214413111111112411111111111111111111-----------11--11-----------------------------------------------------12--1-----------211---------2---1331---1-1112111--1-17111-1--1329671125344333333332332-33633533723-5337234333228553-3643233245--------221-23-2-----------------------------2-3I2-7763678A6752444277754444-464G3A6615443334225572B5331----111111111---211121--1-1-21111111111111-111112-1---1111111--1------------11--1111--2-------------------------11-------32221211221111122-2212111211212221223322222214242434444434324422122221-122233323333---1----------1125--------------1111111-1111144444326123211122-----------------------11122222222-------1----11--------------------------------------1--------11 ----222-----1113443734398872222221212333233222434976EB44543333213-1---111131111112222211-22242223222212211-121424212211--12-221217F4-3231211312311-1--2-1222214322134423233112211117111--21322221221221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 281 STR:RPRED 100.0 SQ:SECSTR cEEEEEEETTEEEEEEcTTccEEEEcccHHHHHHHHHHHccccEEEccHHHHHHHcEETTEHHHHHTTccccEEEEcccccccccccEEEEcGGGEEccccTTcHHHHcccEEEccccccEEccEEEEEEEccccccccHHHHGGGEEEEEEEEccEEHHHHHcHccccHHHHccTTcEEEEEEEEccccTTcGGccEEEEEETTEEEEEEEGGGccccHHHHHHHHHTTccccTTcEEEcccccEEEEcccccccccTTcEEEEEETTTEEEEEEEEEEc PSIPRED cEEEEEccccEEEEEEEEcccEEEcHHHHHHHHccccccHHHHHHHHHcccccccccccccEEEcccccccEEEEEEccHHHHHHHcccccccccEEEEcccccEEcccccEEcccccccccccEEEEEEEccccccccHHHHHHHHcEEEEEEEEEHHHHHHccccccccccccccccccccEEEcHHHcccHHccEEEEEEccEEEEEccHHHHcccHHHHHHHHHcccEEccccEEEEccccccccccccccEEccccEEEEEEccEEEEEEEEEEEc //