[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : hslV
DDBJ      :hslV         ATP-dependent protease
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  589/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
d.153.1
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->171 1m4yA PDBj 1e-53 58.2 %
:RPS:PDB   2->171 1e94A PDBj 3e-34 59.4 %
:RPS:SCOP  2->171 1e94A  d.153.1.4 * 2e-34 59.4 %
:HMM:SCOP  2->172 1g3kA_ d.153.1.4 * 6.6e-48 42.1 %
:RPS:PFM   2->168 PF00227 * Proteasome 2e-12 35.8 %
:HMM:PFM   2->171 PF00227 * Proteasome 2.3e-28 30.4 168/190  
:BLT:SWISS 2->171 HSLV_PARL1 3e-64 65.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21156.1 GT:GENE hslV GT:PRODUCT ATP-dependent protease GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 328148..328663 GB:FROM 328148 GB:TO 328663 GB:DIRECTION + GB:GENE hslV GB:PRODUCT ATP-dependent protease GB:NOTE heat shock hslV GB:PROTEIN_ID AAZ21156.1 GB:DB_XREF GI:71062153 GB:GENE:GENE hslV LENGTH 171 SQ:AASEQ MTTIVLIRKNNEVVVAGDGQVSMGNTVIKSTAAKVRKIEKRNVIAGFAGSTADALTLFERLEAKLEKHAGNLPRAAVELAKDWRTDKYLRRLEALMAIGDKENSFIISGTGDVLEPEGDAIGIGSGGNYALAAAKVLLDTDLSAEEVARKAIQVASEICVFTNNNIKIEKI GT:EXON 1|1-171:0| BL:SWS:NREP 1 BL:SWS:REP 2->171|HSLV_PARL1|3e-64|65.3|170/182| BL:PDB:NREP 1 BL:PDB:REP 2->171|1m4yA|1e-53|58.2|170/171| RP:PDB:NREP 1 RP:PDB:REP 2->171|1e94A|3e-34|59.4|170/174| RP:PFM:NREP 1 RP:PFM:REP 2->168|PF00227|2e-12|35.8|165/189|Proteasome| HM:PFM:NREP 1 HM:PFM:REP 2->171|PF00227|2.3e-28|30.4|168/190|Proteasome| GO:PFM:NREP 3 GO:PFM GO:0004298|"GO:threonine-type endopeptidase activity"|PF00227|IPR001353| GO:PFM GO:0005839|"GO:proteasome core complex"|PF00227|IPR001353| GO:PFM GO:0051603|"GO:proteolysis involved in cellular protein catabolic process"|PF00227|IPR001353| RP:SCP:NREP 1 RP:SCP:REP 2->171|1e94A|2e-34|59.4|170/174|d.153.1.4| HM:SCP:REP 2->172|1g3kA_|6.6e-48|42.1|171/173|d.153.1.4|1/1|N-terminal nucleophile aminohydrolases (Ntn hydrolases)| OP:NHOMO 632 OP:NHOMOORG 616 OP:PATTERN -------------------------------------------------------------------- 111--------------------------------------------------------------------------------11111--------1---------111----------------11111111111---------1----------------------------------------11---111111111111111111111111111111111111111111111111111111111111111111111-11111--11111--------------------------------------------------1------------------------------1111111111111111---11-111111111111111111111111111111111-11111111111111111111111111111111111111111111111111-11111111111111--11111111111111111111111111111111111111111111111111111111--111111111--1111111---11-------111111-11111111111111-------1-11111-111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111----------111111111111111111111111111111111111111111111111111111111--11111111111111111---------------------------1111111111--- 11--11--311-------------------------------------------------------------------------------------------------21------------------------------------------------1----------------1111B111-11-----2113111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 170 STR:RPRED 99.4 SQ:SECSTR #cEEEEEEcccEEEEEEcccEEETTEEEEcccccEEEETTTTEEEEEEEcHHHHHHHHHHHHHHHHTTTTcHHHHHHHHHHHHHHcTTGGGccEEEEEEccccEEEEETTTEEEccTTccEEEETTHHHHHHHHHHHHTccccHHHHHHHHHHHHHHHcTTcccccEEEEE DISOP:02AL 171-172| PSIPRED ccEEEEEEEccEEEEEEccccccccEEEEccccEEEEEcccEEEEEEcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccEEEEEEEccccEEEEEccccEEEEEccEEEEEccHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccEEEEEc //