[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : hupA
DDBJ      :hupA         non-specific DNA-binding protein HBsu
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  715/915 : Eukaryota  4/199 : Viruses  2/175   --->[See Alignment]
a.55.1
:91 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->87 1hueA PDBj 3e-18 44.8 %
:RPS:PDB   1->91 3c4iA PDBj 1e-19 34.1 %
:RPS:SCOP  1->68 1b8zA  a.55.1.1 * 2e-14 34.3 %
:HMM:SCOP  1->90 1exeA_ a.55.1.1 * 1.1e-27 47.8 %
:RPS:PFM   1->87 PF00216 * Bac_DNA_binding 4e-15 48.3 %
:HMM:PFM   1->90 PF00216 * Bac_DNA_binding 5e-34 48.9 90/90  
:BLT:SWISS 1->87 DBH1_BACSU 3e-20 49.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21634.1 GT:GENE hupA GT:PRODUCT non-specific DNA-binding protein HBsu GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 791591..791866 GB:FROM 791591 GB:TO 791866 GB:DIRECTION + GB:GENE hupA GB:PRODUCT non-specific DNA-binding protein HBsu GB:NOTE similar to Escherichia coli hupA and hupB GB:PROTEIN_ID AAZ21634.1 GB:DB_XREF GI:71062631 GB:GENE:GENE hupA LENGTH 91 SQ:AASEQ MNKKQLIAQLSGSLNLSKADAERTFDTITNTILDALKGDDTVKIAGFGTYKVAKRKARVGRNPRTGEQIQIGASQKVKFLPAKALKEIFNK GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 1->87|DBH1_BACSU|3e-20|49.4|87/92| BL:PDB:NREP 1 BL:PDB:REP 1->87|1hueA|3e-18|44.8|87/90| RP:PDB:NREP 1 RP:PDB:REP 1->91|3c4iA|1e-19|34.1|91/99| RP:PFM:NREP 1 RP:PFM:REP 1->87|PF00216|4e-15|48.3|87/90|Bac_DNA_binding| HM:PFM:NREP 1 HM:PFM:REP 1->90|PF00216|5e-34|48.9|90/90|Bac_DNA_binding| GO:PFM:NREP 1 GO:PFM GO:0003677|"GO:DNA binding"|PF00216|IPR000119| RP:SCP:NREP 1 RP:SCP:REP 1->68|1b8zA|2e-14|34.3|67/67|a.55.1.1| HM:SCP:REP 1->90|1exeA_|1.1e-27|47.8|90/99|a.55.1.1|1/1|IHF-like DNA-binding proteins| OP:NHOMO 1516 OP:NHOMOORG 722 OP:PATTERN ------------------------------1------------------------------------- 342-1-------------------------------1----11151--1------------1--1--11111111111----1-11122211-311----1-11-11------------------112112112221-------2-731-221--111111111--21111111111111111-1-1111-211333333333344344221112334111111111111112-11111111111111111111112112111111111112111-111111-111111-----1-----1-11111111111111111111-211111111111111211111111-11111111--11221111111211-1315332111112-3123332222111111111111-22-23-3-214-233411122211232322223533322555555553423483311-11111--11111111111111111113133322211-3335334333333563233333453343225441123231424333-263243111211122112142133226233445144466444833232132-----------------------1-334441335214324444333444334333331-1323211-11133333333333333233-33333333333333333333333333333333333333333333333333331333333333333--5311111111133332111221122222222222222211143444433333333333321111111112644333333445432222222222222211B-----------------1-21-----1--------1--------21111-1112-1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------------1------ ---------------------------1--------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 91 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHTTccEEETTTEEEEEEEEccEEEEcTTTccEEEEccEEEEEEEEcHHHHHHHHT DISOP:02AL 59-60| PSIPRED ccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEcccEEEEEEEEccccccccccccEEEEccccEEEEcccHHHHHHHcc //