[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ibpA
DDBJ      :ibpA         heat shock protein a
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  270/915 : Eukaryota  3/199 : Viruses  3/175   --->[See Alignment]
b.15.1
:148 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   19->130 2bolA PDBj 4e-14 19.1 %
:RPS:SCOP  4->147 1gmeA  b.15.1.1 * 2e-18 24.6 %
:HMM:SCOP  1->149 1gmeA_ b.15.1.1 * 3.6e-23 27.9 %
:RPS:PFM   52->144 PF00011 * HSP20 3e-07 35.6 %
:HMM:PFM   48->148 PF00011 * HSP20 2.6e-19 34.0 97/102  
:BLT:SWISS 16->147 IBPA_SHISS 1e-24 43.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21002.1 GT:GENE ibpA GT:PRODUCT heat shock protein a GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 183448..183894 GB:FROM 183448 GB:TO 183894 GB:DIRECTION + GB:GENE ibpA GB:PRODUCT heat shock protein a GB:PROTEIN_ID AAZ21002.1 GB:DB_XREF GI:71061999 GB:GENE:GENE ibpA LENGTH 148 SQ:AASEQ MTSRDLSIFNTLRPFSIGFDDMFDQFENMLGNGGLTMQSNYPPYNIRKTGKDNYAIEVALAGFNKNDVEVEFEDNLLTVRTKQVDKSEDKSDDGEIIHKGISQRQFARSFTIAEDVKVNGAELKDGLLTIACERIVPEYKKKKLIEIK GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 16->147|IBPA_SHISS|1e-24|43.4|122/137| RP:PDB:NREP 1 RP:PDB:REP 19->130|2bolA|4e-14|19.1|94/301| RP:PFM:NREP 1 RP:PFM:REP 52->144|PF00011|3e-07|35.6|90/101|HSP20| HM:PFM:NREP 1 HM:PFM:REP 48->148|PF00011|2.6e-19|34.0|97/102|HSP20| RP:SCP:NREP 1 RP:SCP:REP 4->147|1gmeA|2e-18|24.6|142/150|b.15.1.1| HM:SCP:REP 1->149|1gmeA_|3.6e-23|27.9|147/0|b.15.1.1|1/1|HSP20-like chaperones| OP:NHOMO 527 OP:NHOMOORG 276 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------1------------------------------11-1------------------------------------------------------------------------------------11111--11--1---------1----------------------------------------------------------------------------------------------------------------------------------------------------------------222512122317334632222222222221223-3633345324212442445354332211122322222222222222223332222-----------------------------121131-------------------------------------------------11--1---------------------------------------------------------------------1---2--22-1121112-11111111111111111111------1--11122332212222222222-222222222222222222234422--13332333333333323222222222-2222222222221121-----1111-1--1---------------------1---3211111111111111111----------22121111111111--------------------------------1------------------------------1--------- ---------------------1---------------------------------------------------------------------------------------------------------------------------------------------1---------1------------------------- -----1-----------------11------------------------------------------------------------------------------------------------------------------------------------------------------ STR:NPRED 130 STR:RPRED 87.8 SQ:SECSTR ##################TEEEEccccccccccccccccEEEEEEcTTccEEEEEEEEccTTccGGGEEEEEcccEEEEEEEEccccccccTTccccccccccEEEEEEEEcccEEcGGGEEEETTEEEEEEEccccccccccccccc DISOP:02AL 30-38, 81-95| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccEEEEEEEcccccHHcEEEEEEccEEEEEEEEcccccccccccEEEEEEEEEEEEEEEEEcccccEEEEcEEEccEEEEEEccccccccccEEEEcc //