Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ilvC
DDBJ      :ilvC         ketol-acid reductoisomerase
Swiss-Prot:ILVC_PELUB   RecName: Full=Ketol-acid reductoisomerase;         EC=;AltName: Full=Acetohydroxy-acid isomeroreductase;AltName: Full=Alpha-keto-beta-hydroxylacil reductoisomerase;

Homologs  Archaea  52/68 : Bacteria  733/915 : Eukaryota  110/199 : Viruses  0/175   --->[See Alignment]
:337 amino acids
:BLT:PDB   1->326 1np3A PDBj e-109 58.5 %
:RPS:PDB   13->294 3db2C PDBj 9e-27 9.6 %
:RPS:SCOP  12->166 1qmgA2  c.2.1.6 * 2e-20 31.8 %
:RPS:SCOP  182->326 1np3A1  a.100.1.2 * 1e-11 64.8 %
:HMM:SCOP  1->181 1np3A2 c.2.1.6 * 3.3e-70 60.6 %
:HMM:SCOP  182->331 1qmgA1 a.100.1.2 * 4.7e-69 62.4 %
:RPS:PFM   11->166 PF07991 * IlvN 5e-53 61.9 %
:RPS:PFM   182->325 PF01450 * IlvC 4e-45 58.7 %
:HMM:PFM   12->176 PF07991 * IlvN 1.6e-73 59.1 164/165  
:HMM:PFM   182->326 PF01450 * IlvC 4.1e-60 52.1 144/145  
:BLT:SWISS 1->337 ILVC_PELUB 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20826.1 GT:GENE ilvC GT:PRODUCT ketol-acid reductoisomerase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(516..1529) GB:FROM 516 GB:TO 1529 GB:DIRECTION - GB:GENE ilvC GB:PRODUCT ketol-acid reductoisomerase GB:PROTEIN_ID AAZ20826.1 GB:DB_XREF GI:71061823 GB:GENE:GENE ilvC LENGTH 337 SQ:AASEQ MFYEKDADVDLIKSKKIAIFGYGSQGHAHALNLKDSGAKEVVVALRDGSASKAKAESKGLRVMNMSDAAEWAEVAMILTPDELQASIYKNHIEQRIKQGTSLAFAHGLNIHYKLIDARKDLDVFMVAPKGPGHLVRSEFERGGGVPCLFAVHQDGTGKARDLALSYASAIGGGKSGIIETTFKDECETDLFGEQSVLCGGLVELIKNGFETLTEAGYEPEMAYFECLHEVKLIVDLIYEGGIANMNYSISNTAEYGEYVSGKKVVDSESKKRMKEVLADIQSGKFTKDWMKECEGGQKNFLKMRKDLADHPIEKVGAELRAMMPWIGKKKLIDSDKS GT:EXON 1|1-337:0| SW:ID ILVC_PELUB SW:DE RecName: Full=Ketol-acid reductoisomerase; EC=;AltName: Full=Acetohydroxy-acid isomeroreductase;AltName: Full=Alpha-keto-beta-hydroxylacil reductoisomerase; SW:GN Name=ilvC; OrderedLocusNames=SAR11_0001; SW:KW Amino-acid biosynthesis; Branched-chain amino acid biosynthesis;Complete proteome; NADP; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->337|ILVC_PELUB|0.0|100.0|337/337| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009082|"GO:branched chain family amino acid biosynthetic process"|Branched-chain amino acid biosynthesis| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| SEG 167->178|asaigggksgii| BL:PDB:NREP 1 BL:PDB:REP 1->326|1np3A|e-109|58.5|325/327| RP:PDB:NREP 1 RP:PDB:REP 13->294|3db2C|9e-27|9.6|281/339| RP:PFM:NREP 2 RP:PFM:REP 11->166|PF07991|5e-53|61.9|155/165|IlvN| RP:PFM:REP 182->325|PF01450|4e-45|58.7|143/145|IlvC| HM:PFM:NREP 2 HM:PFM:REP 12->176|PF07991|1.6e-73|59.1|164/165|IlvN| HM:PFM:REP 182->326|PF01450|4.1e-60|52.1|144/145|IlvC| GO:PFM:NREP 6 GO:PFM GO:0004455|"GO:ketol-acid reductoisomerase activity"|PF07991|IPR013116| GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF07991|IPR013116| GO:PFM GO:0055114|"GO:oxidation reduction"|PF07991|IPR013116| GO:PFM GO:0004455|"GO:ketol-acid reductoisomerase activity"|PF01450|IPR000506| GO:PFM GO:0009082|"GO:branched chain family amino acid biosynthetic process"|PF01450|IPR000506| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01450|IPR000506| RP:SCP:NREP 2 RP:SCP:REP 12->166|1qmgA2|2e-20|31.8|154/226|c.2.1.6| RP:SCP:REP 182->326|1np3A1|1e-11|64.8|145/145|a.100.1.2| HM:SCP:REP 1->181|1np3A2|3.3e-70|60.6|180/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 182->331|1qmgA1|4.7e-69|62.4|149/288|a.100.1.2|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 967 OP:NHOMOORG 895 OP:PATTERN ---1--1122222231-11111111--11111111111111111121111111111-----1--1-11 1111111111111111111-111111111111111111111111111-111111111111112111112112111222-11-111111111111---11--111111111---------------11111111111111111111111111111111111111111111111111111111111111111-11122222222122222211111122211111--1111111111111111111111111111---------------------1-111-------11111111111111-------------111111111-11-11-------1-111221---1-1--111111111111-111111--1-11111111111111111111111111111111111-11111111111-111111111111111121111111111111111111111111111---------------------------11111111111111111122211111222212111111111111111111111111111111111111111111111-1112111111111-1111111111111-1121111111111111111111111111111111111-1111111111111111111111-1-111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-----------11111111111-11111111111111111111111111111111111111-1-1111-111111111111111111111111111111111111111--------------------------------------1--1-111121 --------------1111-11111111-1111111111-1111-1111111111111-1111111111-11111111-1111111111-24211211111111212--1----------------------------------------------------------------1-1111B1111122231111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 333 STR:RPRED 98.8 SQ:SECSTR cccGGGccccHHccEEEEEEcccHHHHHHHHHTTcTTEEEEEEEEcccHHHHHHHHHHHTcEEcccHHHHTcTTccEEEcHHHHHHHHHTTcEEEEEccccccHHHHHHHHHHHHHHcccEEEEcGGGGcHHHHHHHHHTTTTccEEEEEEEEEccHHHHccTTcGGGcTTTcTTTHHHHTHHHHHHHHHHccEEEEEEEEEcccccccccEEEEEEEETTEEEEEEcccccEEEEEEEEccEEEEEEEcGGGcccTTTGGGGEEEEEEEEccccEEEEEEccccccHHHHHHHcccHHHHHHHHHHHcccccHHHHHHcccccEcHHHHHHH#### DISOP:02AL 333-337| PSIPRED cccccccccHHHcccEEEEEEEcccHHHHHHHHHHccccEEEEEEcccHHHHHHHHHcccEEccHHHHHHHccEEEEEcccHHHHHHHHHHHHHHcccccEEEEEccEEEEEccEEcccccEEEEEccccccHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHccccccccccccccc //