[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ilvE
DDBJ      :ilvE         branched-chain amino acid aminotransferase
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  756/915 : Eukaryota  94/199 : Viruses  0/175   --->[See Alignment]
e.17.1
:293 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->265 1iyeA PDBj 5e-48 39.8 %
:RPS:PDB   7->292 2ej0D PDBj 1e-76 38.8 %
:RPS:SCOP  7->292 1a3gA  e.17.1.1 * 1e-70 36.4 %
:HMM:SCOP  9->288 1daaA_ e.17.1.1 * 2.3e-83 37.4 %
:RPS:PFM   50->265 PF01063 * Aminotran_4 3e-29 35.2 %
:HMM:PFM   50->272 PF01063 * Aminotran_4 1.2e-36 29.2 216/232  
:BLT:SWISS 1->289 ILVE_RICCN 2e-63 44.2 %
:PROS 191->220|PS00770|AA_TRANSFER_CLASS_4

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20910.1 GT:GENE ilvE GT:PRODUCT branched-chain amino acid aminotransferase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(100928..101809) GB:FROM 100928 GB:TO 101809 GB:DIRECTION - GB:GENE ilvE GB:PRODUCT branched-chain amino acid aminotransferase GB:PROTEIN_ID AAZ20910.1 GB:DB_XREF GI:71061907 GB:GENE:GENE ilvE LENGTH 293 SQ:AASEQ MIPYDKRSGKIWFNGELVDWADAKIHVLNHGLHYASCVFEGERVYDNSIFKLEEHTSRLFYSAKRMGIKIPYTEEEINLASKKIISVQGVKDGYVRPTIWRGSEMMAISAQQTKIHVAIATWEWGSYFDPKLKIEGIKLNISNWRRPAPNTIPWDTKASGLYMICTLSKHEAEQQGYTDSLMLDHEGNVAEATGANIFFKDKNGEIHTPIPDSFLDGITRRTVIEIAKSKGIKVNERKIAPAELSNFVGCFLTGTAAEVTPVSCIAENKFKVCETIIDLNESYQALVRKRKAA GT:EXON 1|1-293:0| BL:SWS:NREP 1 BL:SWS:REP 1->289|ILVE_RICCN|2e-63|44.2|283/290| PROS 191->220|PS00770|AA_TRANSFER_CLASS_4|PDOC00618| BL:PDB:NREP 1 BL:PDB:REP 11->265|1iyeA|5e-48|39.8|254/304| RP:PDB:NREP 1 RP:PDB:REP 7->292|2ej0D|1e-76|38.8|281/301| RP:PFM:NREP 1 RP:PFM:REP 50->265|PF01063|3e-29|35.2|210/220|Aminotran_4| HM:PFM:NREP 1 HM:PFM:REP 50->272|PF01063|1.2e-36|29.2|216/232|Aminotran_4| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01063|IPR001544| GO:PFM GO:0008152|"GO:metabolic process"|PF01063|IPR001544| RP:SCP:NREP 1 RP:SCP:REP 7->292|1a3gA|1e-70|36.4|275/295|e.17.1.1| HM:SCP:REP 9->288|1daaA_|2.3e-83|37.4|273/277|e.17.1.1|1/1|D-aminoacid aminotransferase-like PLP-dependent enzymes| OP:NHOMO 1335 OP:NHOMOORG 887 OP:PATTERN ------------------111--1211223221111111111211111111111-----------122 1121-111111-11----------1------111111132-211111211111111-111111111132-111111111111121111111-1111-111--2111-212---------------111111111112222211122311211111221111111122---1111211111211-111111-114444444554453445234443445212-2221221211212222222222222222222-1-11112-1-----11-1-1111111111111111-11--1--1--1111111111111111111111123223111121-1222-223111111-21112123211111222111--1111-111--1--2232122-2321-22222222115-22222211353-42223323323312152454444432422222222111-1124----------111111111111111----1112-21222213313241111111122221221231111122211111111221111111111111111111112221112221112111111111111-212211-212222111112111111111111111111211221111-------1112-1-11-12---1111------11121111111111111-1111111111111111111111341311111111111111111111111112-11111111111111--1111111112121111111--1111111111111111111111111111111111111111-1111111221111111111111111111111111221-111111----------1-------------------------12-1111111111 ------1---2----1---122222221111111212111-111111233227411111111111-11121111222122111122----1---------1--112-16-------------------------------------------------------------5--1-2-11P2213-8357-A5331---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 100.0 SQ:SECSTR EEEEETccccEEETTEEEcGGGccccTTcHHHHHccEEEccEEEEEETEEcHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHTTcccEEEEEEEEcccccccccGGGcccEEEEEEEEccccccTTHHHHcEEEEEcccccccTTTccTTcccGGGHHHHHHHHHHHHHTTccEEEEEcTTccEEEEcccEEEEEGETTEEEEEccTTccccHHHHHHHHHHHHTTcEEEEEcccHHHHHTccEEEEEETTTEEEEEEEETTEEccccHHHHHHHHHHHHHHTTccGG DISOP:02AL 291-293| PSIPRED ccEEEccccEEEEccEEEcccccEEcHHHHHHHcccEEEEEEEEEccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccEEEEEEEEEccccccccccccccEEEEEEEEccccccccHHcccEEEEEEEcEEccccccccccccHHHHHHHHHHHHHHHHccccEEEEEcccccEEEEcccEEEEEEccEEEEccccccccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHEEEEEcccEEEEEEEEEccEEEcccHHHHHHHHHHHHHHHHcccc //