[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ispD
DDBJ      :ispD         IspD/ispF bifunctional enzyme
Swiss-Prot:ISPDF_PELUB  RecName: Full=Bifunctional enzyme ispD/ispF;Includes:  RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;           EC=2.7.7.60;  AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol synthase;  AltName: Full=MEP cytidylyltransferase;           Short=MCT;Includes:  RecName: Full=2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase;           Short=MECPS;           Short=MECDP-synthase;           EC=4.6.1.12;

Homologs  Archaea  2/68 : Bacteria  679/915 : Eukaryota  26/199 : Viruses  0/175   --->[See Alignment]
c.68.1d.79.5
:371 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->367 1w57A PDBj 4e-33 31.8 %
:RPS:PDB   6->105 3dj4A PDBj 2e-11 18.0 %
:RPS:PDB   214->369 3b6nA PDBj 1e-22 33.6 %
:RPS:SCOP  6->186 1vpaA  c.68.1.13 * 3e-27 22.2 %
:RPS:SCOP  217->369 1gx1A  d.79.5.1 * 1e-44 41.8 %
:HMM:SCOP  2->215 1w55A1 c.68.1.13 * 1.8e-46 32.0 %
:HMM:SCOP  214->368 1jy8A_ d.79.5.1 * 4.8e-57 41.3 %
:RPS:PFM   6->185 PF01128 * IspD 2e-15 30.2 %
:RPS:PFM   214->364 PF02542 * YgbB 1e-31 41.7 %
:HMM:PFM   215->369 PF02542 * YgbB 5.1e-60 49.0 155/157  
:HMM:PFM   4->211 PF01128 * IspD 2.8e-46 31.9 207/221  
:BLT:SWISS 1->371 ISPDF_PELUB e-167 100.0 %
:PROS 97->104|PS01295|ISPD
:PROS 248->263|PS01350|ISPF
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21757.1 GT:GENE ispD GT:PRODUCT IspD/ispF bifunctional enzyme GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(928972..930087) GB:FROM 928972 GB:TO 930087 GB:DIRECTION - GB:GENE ispD GB:PRODUCT IspD/ispF bifunctional enzyme GB:NOTE Includes: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; similar to Swiss-Prot Accession Number Q9PM68 GB:PROTEIN_ID AAZ21757.1 GB:DB_XREF GI:71062754 GB:GENE:GENE ispD LENGTH 371 SQ:AASEQ MNSCFIILAGGESKRFNSNTPKPYTNYKGKPLLLHSIDKAKVFNKFNKIVLVVNKKHKNFIKKLNIKNIRIITGGKTRAESAYNALKSIKENNFKNVIIHDAARPNFSLKLLNKLMNELKLNDCVIPAIQTADTVKQKISNNVKNLKRENIYLIQTPQAFNYKKLFELQNNKSEEVTDDANLFVRAGKKIKIIKGETTNNKITINSDIKFNNLIKFGIGFDVHRLVPNKKLYLGGVKIPSPIGTLGHSDGDPVLHAVTDAILGACSMGDIGEKFSDKNKKFKNIRSTILLSEIIKQTLKKGYLINNLDINIITQKPKIQKYKKQILNCIAKICNISPTQINIKGKTTEKLGVIGKEKAIACEVIASVIKND GT:EXON 1|1-371:0| SW:ID ISPDF_PELUB SW:DE RecName: Full=Bifunctional enzyme ispD/ispF;Includes: RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; EC=2.7.7.60; AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT;Includes: RecName: Full=2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; Short=MECPS; Short=MECDP-synthase; EC=4.6.1.12; SW:GN Name=ispDF; OrderedLocusNames=SAR11_0945; SW:KW Complete proteome; Isoprene biosynthesis; Lyase; Metal-binding;Multifunctional enzyme; Nucleotidyltransferase; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->371|ISPDF_PELUB|e-167|100.0|371/371| GO:SWS:NREP 6 GO:SWS GO:0008299|"GO:isoprenoid biosynthetic process"|Isoprene biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 97->104|PS01295|ISPD|PDOC00997| PROS 248->263|PS01350|ISPF|PDOC01048| SEG 54->72|nkkhknfikklniknirii| SEG 109->122|lkllnklmnelkln| SEG 187->205|gkkikiikgettnnkitin| SEG 311->325|iitqkpkiqkykkqi| BL:PDB:NREP 1 BL:PDB:REP 6->367|1w57A|4e-33|31.8|349/368| RP:PDB:NREP 2 RP:PDB:REP 6->105|3dj4A|2e-11|18.0|100/462| RP:PDB:REP 214->369|3b6nA|1e-22|33.6|140/150| RP:PFM:NREP 2 RP:PFM:REP 6->185|PF01128|2e-15|30.2|179/222|IspD| RP:PFM:REP 214->364|PF02542|1e-31|41.7|151/157|YgbB| HM:PFM:NREP 2 HM:PFM:REP 215->369|PF02542|5.1e-60|49.0|155/157|YgbB| HM:PFM:REP 4->211|PF01128|2.8e-46|31.9|207/221|IspD| GO:PFM:NREP 4 GO:PFM GO:0003824|"GO:catalytic activity"|PF01128|IPR001228| GO:PFM GO:0008299|"GO:isoprenoid biosynthetic process"|PF01128|IPR001228| GO:PFM GO:0008685|"GO:2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity"|PF02542|IPR003526| GO:PFM GO:0016114|"GO:terpenoid biosynthetic process"|PF02542|IPR003526| RP:SCP:NREP 2 RP:SCP:REP 6->186|1vpaA|3e-27|22.2|180/221|c.68.1.13| RP:SCP:REP 217->369|1gx1A|1e-44|41.8|153/157|d.79.5.1| HM:SCP:REP 2->215|1w55A1|1.8e-46|32.0|203/0|c.68.1.13|1/1|Nucleotide-diphospho-sugar transferases| HM:SCP:REP 214->368|1jy8A_|4.8e-57|41.3|155/155|d.79.5.1|1/1|IpsF-like| OP:NHOMO 837 OP:NHOMOORG 707 OP:PATTERN --------------------------------1---------------------------1------- 111-1-1-------11111-1-111-1111111---1----1-1-----1111-----11---1---1--1-------111112112222222311---------22112-------1-11111-111-1111111-----111-111111111111111111111111111111111121-1-----2211221111111121111112222221112221-12222221212---1---------------1----------1---------------------1------------------------------------212222222222223-122222222-22122111121122111111111-111111111111111111111111111111111111-22111111111-11111111111111111111111111111111111111111111122222222---------------111111111111111111111111111111111111111111111111111111111111111111111111111211-11-111111111111111111111111111--221111111111111111111111211111111111112111111111111111111111--11111--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111-112---------1111111122112222111111111111111111111111111111111222222222-1111111111121111111111111111--21112222--------11------------1------1------1222222222121 11------1----------------11---------------------------------------------------------------------------------2-------------------------------------------------------------2----11117221112113-3211----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 369 STR:RPRED 99.5 SQ:SECSTR TcEEEEEEEccccGGGcccccGGGcEETTEEHHHHHHHHHHHHcccEEEEEEcccHHHHTTTTTTHHHHTTccccccHHHHHHHHHTTccTTcccEEEEEETTcTTccTTHHHHHHHTcTTccEEEEEccccEEEEEEEcccEETTHHHHHHHHHHTTccEEHHHHHHHTccccccccHHHHHHTTTccEEEEEccGGGcccccGGGGGGcccEEEEEEEEEEEEEcccEEEETTEEEEEEEEEEEcccccHHHHHHHHHHHHHTTccccTHHHccccccTTTccHHHHHHHHHHHHHHTTEEEEEEEEEEEccccccHHHHHHHHHHHHHHHTccGGGEEEEEEccTTcHHHHTTcEEEEEEEEEEEE## PSIPRED ccEEEEEEccccccccccccccEEEEEccEEHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHcccEEEEEEEcccEEEEcccEEEEcccccEEEEEccccccHHHHHHHHHHccccccHHHHHHHHccccEEEEEcccHHHccccHHHHHHHHHHHHcccccHHHcccccEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHccccccEEcccccHHHccccHHHHHHHHHHHHHHcccEEEEEEEEEEEcccccccHHHHHHHHHHHHHcccHHHEEEEEEEcccccccccccEEEEEEEEEEEEcc //