[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ispE
DDBJ      :ispE         4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Swiss-Prot:ISPE_PELUB   RecName: Full=4-diphosphocytidyl-2-C-methyl-D-erythritol kinase;         Short=CMK;         EC=2.7.1.148;AltName: Full=4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.14.1d.58.26
:281 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   167->262 2v2qB PDBj 7e-05 27.7 %
:RPS:PDB   1->68,166->275 2aj4A PDBj 9e-08 10.1 %
:RPS:SCOP  5->96 1oj4A1  d.14.1.5 * 2e-10 25.6 %
:RPS:SCOP  166->275 1oj4A2  d.58.26.5 * 3e-15 22.5 %
:HMM:SCOP  2->160 1oj4A1 d.14.1.5 * 4.7e-20 26.1 %
:HMM:SCOP  161->278 1oj4A2 d.58.26.5 * 6.3e-20 28.2 %
:HMM:PFM   210->267 PF08544 * GHMP_kinases_C 1.3e-05 27.3 55/82  
:HMM:PFM   89->127 PF00288 * GHMP_kinases_N 0.00011 23.1 39/68  
:BLT:SWISS 1->281 ISPE_PELUB e-118 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20929.1 GT:GENE ispE GT:PRODUCT 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(116257..117102) GB:FROM 116257 GB:TO 117102 GB:DIRECTION - GB:GENE ispE GB:PRODUCT 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase GB:PROTEIN_ID AAZ20929.1 GB:DB_XREF GI:71061926 GB:GENE:GENE ispE LENGTH 281 SQ:AASEQ MNSFKIKSYAKINLALNVTGKKSKLHNIESLISFIDLHDSITITESNTKQHKINFIGRFSKNISKINTISKLLKILDNKKLLNNKKFEIKVIKHIPQKAGMGGGSMNAASLLNFFIEKKLIKIKKNDSKKISNEIGSDVILGIKPSLAILLSNGDIKKFKNKIKFHILVAKPNFGCSTKYIYSKVDSFSKPQFNPPKQKLFEAKYLKNLDNDLEKVALNKYPELKRIKSYLNGLPNTLFVRMSGSGSSIVAYFHSKKACKKACSQYKRKFNNHWCIESKTI GT:EXON 1|1-281:0| SW:ID ISPE_PELUB SW:DE RecName: Full=4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Short=CMK; EC=2.7.1.148;AltName: Full=4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase; SW:GN Name=ispE; OrderedLocusNames=SAR11_0105; SW:KW ATP-binding; Complete proteome; Isoprene biosynthesis; Kinase;Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->281|ISPE_PELUB|e-118|100.0|281/281| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0008299|"GO:isoprenoid biosynthetic process"|Isoprene biosynthesis| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 71->86|kllkildnkkllnnkk| SEG 99->135|agmgggsmnaasllnffiekklikikkndskkisnei| SEG 156->165|ikkfknkikf| BL:PDB:NREP 1 BL:PDB:REP 167->262|2v2qB|7e-05|27.7|94/270| RP:PDB:NREP 1 RP:PDB:REP 1->68,166->275|2aj4A|9e-08|10.1|173/509| HM:PFM:NREP 2 HM:PFM:REP 210->267|PF08544|1.3e-05|27.3|55/82|GHMP_kinases_C| HM:PFM:REP 89->127|PF00288|0.00011|23.1|39/68|GHMP_kinases_N| RP:SCP:NREP 2 RP:SCP:REP 5->96|1oj4A1|2e-10|25.6|86/163|d.14.1.5| RP:SCP:REP 166->275|1oj4A2|3e-15|22.5|102/120|d.58.26.5| HM:SCP:REP 2->160|1oj4A1|4.7e-20|26.1|157/163|d.14.1.5|1/1|Ribosomal protein S5 domain 2-like| HM:SCP:REP 161->278|1oj4A2|6.3e-20|28.2|110/120|d.58.26.5|1/1|GHMP Kinase, C-terminal domain| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 277 STR:RPRED 98.6 SQ:SECSTR cccEEEEEEEEEEEEcTTcccccGGGTcccEEEEEEEEEEEEEEEEcccccEEEccTTcccEEEEccTEE##HHHHHHHHHETTEEEEccEEccccTTcEEEEEccTccGGGccEEEEEEEccccccTTEEEEEEEETTccccEEEEEEETTEEEEEEEEEEETTEEEEEEccccccTTTTTTTTHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHcccccccccHHHHHHHHTHHHHHHHHHHHGGGTcccHHHHHHHHTccHHHHHHHHHccEEEc## PSIPRED ccEEEEEccEEEEEEEEEEEcccccccEEEEEEEEcccEEEEEEEcccccEEEEEEcccccccccHHHHHHHHHHHHHHHccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccEEccccEEEEEEcccccccccccccEEEEEEccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccEEEEEcccccEEEEEEccHHHHHHHHHHHHHHccccEEEEEEEc //