[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : kipI
DDBJ      :kipI         Allophanate hydrolase subunit 1
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  378/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
b.62.1d.74.5
:228 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->223 2phcB PDBj 1e-35 34.1 %
:RPS:SCOP  5->79 2phcB2  d.74.5.1 * 3e-11 31.0 %
:RPS:SCOP  92->223 2phcB1  b.62.1.4 * 1e-41 38.9 %
:RPS:PFM   9->207 PF02682 * AHS1 2e-30 32.5 %
:HMM:PFM   4->206 PF02682 * AHS1 2.3e-59 34.8 198/202  
:BLT:SWISS 5->228 KIPI_BACSU 7e-27 30.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21483.1 GT:GENE kipI GT:PRODUCT Allophanate hydrolase subunit 1 GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 647262..647948 GB:FROM 647262 GB:TO 647948 GB:DIRECTION + GB:GENE kipI GB:PRODUCT Allophanate hydrolase subunit 1 GB:PROTEIN_ID AAZ21483.1 GB:DB_XREF GI:71062480 GB:GENE:GENE kipI LENGTH 228 SQ:AASEQ MVKNISNLGDAAVYCDFGSEVNEAINSSVIDYFHHISKLIKDKKIEGITNLTPSYNKLIVSFDLTVTNYKKIKNFIEGLTINRDIKNNNQKIKIPVCCDDEYGLDFLRLIEKLNIDKDKILELYFGKEYFCYMTGFIAGMPFLGDLNENIRCDRLETPRVKMPKGSVGITEQFANIYTFESPGGWNIIGNTPKKIFDDKNLDKPALVNPGDKVSFYQITKEEYLNWNE GT:EXON 1|1-228:0| BL:SWS:NREP 1 BL:SWS:REP 5->228|KIPI_BACSU|7e-27|30.2|215/240| BL:PDB:NREP 1 BL:PDB:REP 5->223|2phcB|1e-35|34.1|214/216| RP:PFM:NREP 1 RP:PFM:REP 9->207|PF02682|2e-30|32.5|194/202|AHS1| HM:PFM:NREP 1 HM:PFM:REP 4->206|PF02682|2.3e-59|34.8|198/202|AHS1| RP:SCP:NREP 2 RP:SCP:REP 5->79|2phcB2|3e-11|31.0|71/84|d.74.5.1| RP:SCP:REP 92->223|2phcB1|1e-41|38.9|131/132|b.62.1.4| OP:NHOMO 466 OP:NHOMOORG 394 OP:PATTERN ------------------------------------------------------1111111------- --1-1--11111-1111----111-1------11111322-11-11-1----2211-1--11111111--1--------11----------------------11-------------------------------111-----1--------------------------------------111-----1-111111111111111111111111111111--------1112222222222222221122-------1-------------1-------------------------------------------------1--1-----------111---------1--1--------11-111-11-------------1131211111111------------11111212----4223112321--111---111111-1-11111111---1-1-1-----------------------------1-----221111112212222222112222112211221--112--1--2--212--11---1---11111----1---1-1-----------------------1--1-----11111------------1------111111-111-----------1----12-------------1121-11111111-111-111111111111111111111121111111111111111111111111111--1-1-111-1111---1---------1--11-------1111-11-11-11111-11-111111131111213211---1111--11111111111111-----------------------------------------------------------------------1- -----------------------1-1------------------------------------2-1---------1----------1-----------------------------------------------------------------------------1------------------------1---------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 213 STR:RPRED 93.4 SQ:SECSTR ####EEEccTTEEEEEccccccHHHHHHH####HHHHHHHHHHccTTEEEEEEETTEEEEEEcTTTccHHHHHHHHHHHHHHHHHHHHTTEEEEEEEEcTTTcTTHHHHHHHHTccHHHHHHHHHcccEEEEEEETTTTEEEEEcccGGGccccccccEEEEcTTEEEEEcTEEEEEcccEEEccEEEEEcccccccTTcc#ccccccTTcEEEEEEEccc#c##### DISOP:02AL 228-229| PSIPRED cccEEEEccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccEEEEEEEccccccHHHHHHHHHHHHccccccccccEEEEEEEEcccccccHHHHHHHHcccHHHHHHHHccccEEEEEEEccccccccccccHHHccccccccccccccccEEEcccEEEEEEcccccccEEEEEccccccccccccccEEEccccEEEEEEccHHHHHHHcc //