[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : leuD
DDBJ      :leuD         3-isopropylmalate dehydratase
Swiss-Prot:LEUD_PELUB   RecName: Full=3-isopropylmalate dehydratase small subunit;         EC=4.2.1.33;AltName: Full=Isopropylmalate isomerase;AltName: Full=Alpha-IPM isomerase;         Short=IPMI;

Homologs  Archaea  46/68 : Bacteria  710/915 : Eukaryota  106/199 : Viruses  0/175   --->[See Alignment]
c.8.2
:203 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->172 2hcuA PDBj 2e-38 47.4 %
:RPS:PDB   1->176 1c96A PDBj 6e-49 18.6 %
:RPS:SCOP  18->195 1v7lA  c.8.2.1 * 2e-33 31.5 %
:HMM:SCOP  1->193 1acoA1 c.8.2.1 * 5.4e-56 42.6 %
:RPS:PFM   26->123 PF00694 * Aconitase_C 2e-15 41.8 %
:HMM:PFM   1->123 PF00694 * Aconitase_C 2.1e-42 47.2 123/131  
:BLT:SWISS 1->203 LEUD_PELUB e-118 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21073.1 GT:GENE leuD GT:PRODUCT 3-isopropylmalate dehydratase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(255049..255660) GB:FROM 255049 GB:TO 255660 GB:DIRECTION - GB:GENE leuD GB:PRODUCT 3-isopropylmalate dehydratase GB:PROTEIN_ID AAZ21073.1 GB:DB_XREF GI:71062070 GB:GENE:GENE leuD LENGTH 203 SQ:AASEQ MQKFNSLTSIPAYLPIVNIDTDMIIPKQFLKTIKRTGLGKNLFFEMRYDDNGNEIKDFILNQKPHNQSKILIAGKNFGCGSSREHAPWALLDFGITCVISSSYADIFYSNCFKNGILPITLPEEKIKELSEYSKRKEEISIDLNEEKIIFGNSEIKFDIDPFKKKCLLEGLDDIALSLAKKEKIITFEENLKNNKPWIFNDKN GT:EXON 1|1-203:0| SW:ID LEUD_PELUB SW:DE RecName: Full=3-isopropylmalate dehydratase small subunit; EC=4.2.1.33;AltName: Full=Isopropylmalate isomerase;AltName: Full=Alpha-IPM isomerase; Short=IPMI; SW:GN Name=leuD; OrderedLocusNames=SAR11_0251; SW:KW Amino-acid biosynthesis; Branched-chain amino acid biosynthesis;Complete proteome; Leucine biosynthesis; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->203|LEUD_PELUB|e-118|100.0|203/203| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009082|"GO:branched chain family amino acid biosynthetic process"|Branched-chain amino acid biosynthesis| GO:SWS GO:0009098|"GO:leucine biosynthetic process"|Leucine biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 1->172|2hcuA|2e-38|47.4|171/177| RP:PDB:NREP 1 RP:PDB:REP 1->176|1c96A|6e-49|18.6|167/753| RP:PFM:NREP 1 RP:PFM:REP 26->123|PF00694|2e-15|41.8|98/130|Aconitase_C| HM:PFM:NREP 1 HM:PFM:REP 1->123|PF00694|2.1e-42|47.2|123/131|Aconitase_C| GO:PFM:NREP 1 GO:PFM GO:0008152|"GO:metabolic process"|PF00694|IPR000573| RP:SCP:NREP 1 RP:SCP:REP 18->195|1v7lA|2e-33|31.5|149/162|c.8.2.1| HM:SCP:REP 1->193|1acoA1|5.4e-56|42.6|190/0|c.8.2.1|1/1|LeuD/IlvD-like| OP:NHOMO 1021 OP:NHOMOORG 862 OP:PATTERN ---1----11111111-------221122121222222222222222221332211-----1--1-22 1111111111111111111-111111111111111111221111111--111111111--111-11111111111111-11-211111111111---11--1-1111111---------------11111111111222211111111111111111111111111111111111111111111111122-11111111111111111111111111111111--11111111-1111111111111111111-------1------------1111-1-------11111111111111-------------111111111-12-211111--11-12111----1-1--12112111221111-1111--1-112111-----212221111111111111111111-11211311111-1112111111112143122111111121111111111111111-----------------------------111311143231112111111111211111-1214214311221111111111122211111211111111111111-1211111111111-1111111121111-1121111111111--1--------1-11111111111-2111111111111111111111-1-1111-11--111111121111111111-11-1111111111111111111111112121212222212112111111111-11111111111111-1---------11111111112-11111111111111111121111111221112111111-1-11-1-111111111111111111111111111111111221111--------------------------------------2--2-222111 --------------12211122222121111111111111-11111--13112111221111121111-11211111-1111111122-11121111111111112--1-------------------------------------------------------------------111911-1-2--11311122221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 92.6 SQ:SECSTR HHHcccGGGGGGTccHHHHGGGcTTTcccTTTcccccEEcTTTccEEcHccEEcHHHHHHHHHHHTccEEEEcccccTcccccTHHHHHHHHTTEEEEEEccccHHHHHHHHHTTcEEEEEccGGGGGGccTTccTcEEEEEcGGGccTTccEEEEHHHHHHHHTcHHHHHHHHccHHHHHTcHHHHH############### DISOP:02AL 202-203| PSIPRED ccccEEEEEEEEEEEcccccccccccHHHcccccHHHHHHHHHHHccccccccccHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHcccEEEEEccHHHHHHHHHHHccccEEEEcHHHHHHHHHHHccccEEEEEEcccEEEEccEEEEEEccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccc //