[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : lgt
DDBJ      :lgt          prolipoprotein diacylglyceryl transferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  730/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:256 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->250 PF01790 * LGT 1e-36 39.8 %
:HMM:PFM   6->251 PF01790 * LGT 3.3e-85 46.9 241/257  
:BLT:SWISS 1->250 LGT_RICBR 3e-58 49.6 %
:PROS 110->125|PS00589|PTS_HPR_SER
:PROS 135->147|PS01311|LGT
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20915.1 GT:GENE lgt GT:PRODUCT prolipoprotein diacylglyceryl transferase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 104566..105336 GB:FROM 104566 GB:TO 105336 GB:DIRECTION + GB:GENE lgt GB:PRODUCT prolipoprotein diacylglyceryl transferase GB:NOTE lgt (umpA) GB:PROTEIN_ID AAZ20915.1 GB:DB_XREF GI:71061912 GB:GENE:GENE lgt LENGTH 256 SQ:AASEQ MFINNFDPVAFQIFSLEIRWYSLAYIVGIALGWLYCKKKLIKDSHILQLFDDFITYLIIGMILGGRLGYTLFYNLKYYLDNPIEILMVWNGGMSFHGALIGIIIASILFSKKHNTNSFIFLDLVALSAPIGIFFGRIANFINSELYGRATDLPWSVQFVLIDNIKRHPSQLYEAFFEGIILFFVLGYFFKKDYLKVPGKISALFLIFYSLFRFFIEFFRSPDPQIGYLVLNLTLGQLISVLFFLTGVYLLSLKNEN GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 1->250|LGT_RICBR|3e-58|49.6|250/263| PROS 110->125|PS00589|PTS_HPR_SER|PDOC00318| PROS 135->147|PS01311|LGT|PDOC01015| TM:NTM 7 TM:REGION 1->19| TM:REGION 25->45| TM:REGION 49->71| TM:REGION 82->104| TM:REGION 168->189| TM:REGION 196->218| TM:REGION 227->249| SEG 57->68|liigmilggrlg| SEG 97->110|galigiiiasilfs| RP:PFM:NREP 1 RP:PFM:REP 8->250|PF01790|1e-36|39.8|236/251|LGT| HM:PFM:NREP 1 HM:PFM:REP 6->251|PF01790|3.3e-85|46.9|241/257|LGT| GO:PFM:NREP 4 GO:PFM GO:0009249|"GO:protein lipoylation"|PF01790|IPR001640| GO:PFM GO:0016020|"GO:membrane"|PF01790|IPR001640| GO:PFM GO:0016757|"GO:transferase activity, transferring glycosyl groups"|PF01790|IPR001640| GO:PFM GO:0042158|"GO:lipoprotein biosynthetic process"|PF01790|IPR001640| OP:NHOMO 758 OP:NHOMOORG 731 OP:PATTERN -------------------------------------------------------------------- --1---11111-------------------------1------------------1------1-----2-1-111---11111----111121111-1-11--11--11-11111111111111111111111211-1111-----1-111111---1-----111111111--1111-11-1---11111-1111111-21-1-2---1111--11----1-11------1-111111111111111-11111111111-111111111111---1211111111111111111111111111111111111111111111112212111111111111111----1-111--1121111-121-11-111--1-111111111111111111111111111111111-111112111111111111111111111113111111111111111111111-1111111111111--11111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111-11-211121111111111111------111111111111111111111111111111111211111122222111111211112111-11111-1-11111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111221111111111111111111111111111111111111111111111111111111111111------11111111111-------------------------1111111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 256-257| PSIPRED cccccccHHEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHccc //