[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : lgtF
DDBJ      :lgtF         spsA-like protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  252/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.68.1
:277 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->90 3e26A PDBj 5e-07 20.0 %
:RPS:SCOP  1->132 1omxA  c.68.1.15 * 3e-11 15.6 %
:HMM:SCOP  1->266 1xhbA2 c.68.1.17 * 1.2e-23 19.0 %
:RPS:PFM   6->86 PF00535 * Glycos_transf_2 7e-06 34.6 %
:HMM:PFM   5->93 PF00535 * Glycos_transf_2 1.6e-20 35.6 87/169  
:BLT:SWISS 1->250 Y653_HAEIN 3e-20 34.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21373.1 GT:GENE lgtF GT:PRODUCT spsA-like protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 545259..546092 GB:FROM 545259 GB:TO 546092 GB:DIRECTION + GB:GENE lgtF GB:PRODUCT spsA-like protein GB:PROTEIN_ID AAZ21373.1 GB:DB_XREF GI:71062370 GB:GENE:GENE lgtF LENGTH 277 SQ:AASEQ MNNLCIIILTFNEELNIKKCLGSIKNFADEIIIIDSFSTDNTKSICENYKVKFVQNKFVNQAKQFNWALSNVEVKSEWIMRLDADEEVTENLAREIKKNINIESENNGFYINRKLIWCRKWIRHGGIYPLWLARVFKRGKAVYEERTEEHLLIEGKTSKIRGDLIENNLKNKIEFFTLKHLDTAKGEAKEIFDKNFNKNISSDQIYNKSKIRRFFKINLFNKMPLFFRSTSYFIYRYIFRLGFLDGKEGFTFHFFQAFWYRMFIDMLVDEKKKNEKK GT:EXON 1|1-277:0| BL:SWS:NREP 1 BL:SWS:REP 1->250|Y653_HAEIN|3e-20|34.4|224/254| SEG 95->107|eikkniniesenn| RP:PDB:NREP 1 RP:PDB:REP 1->90|3e26A|5e-07|20.0|90/274| RP:PFM:NREP 1 RP:PFM:REP 6->86|PF00535|7e-06|34.6|81/148|Glycos_transf_2| HM:PFM:NREP 1 HM:PFM:REP 5->93|PF00535|1.6e-20|35.6|87/169|Glycos_transf_2| RP:SCP:NREP 1 RP:SCP:REP 1->132|1omxA|3e-11|15.6|128/250|c.68.1.15| HM:SCP:REP 1->266|1xhbA2|1.2e-23|19.0|263/0|c.68.1.17|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 290 OP:NHOMOORG 253 OP:PATTERN ----------------------------------------------------------1--------- 21---------------------------------------11---------------------------------------111112---1-1-------31-3-21-1-----------------------1-----11---11221-223---------1----2423-------------------1--2--------1----------------------------11-----------------------------------------------------------------------------------------------------------11---------------1-3-11--------11-1-------------1-----------11-111111------------------------------------------------------1-------------1111-11111111----11----111111----11111111111111111121--111111------211---------1-1111111-----11-1-1121--111111--1211--------1211111111111-1---------1--1111111-----1-----1-1--------1-1----------------1-11------------------------------11111111------------------------1-111111111111--11111-111111-1-1111-111111111-1-------11----------1-------------------21111111111-1111111111111111--1-222222------------------------------------1-----1-1-221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 263 STR:RPRED 94.9 SQ:SECSTR TccEEEEEEEcccTTTHHHHHHTTGGGcTEEEEEEccccccHHHHHHHTTcEEEEHHHHcTTccccccHHHTcccccEEEEccTTcccccHHHHHHHHHHHHHTccEEEEEccccTTccHHHHHTHHHHHHHHcTTccGGGcccTTcccEEEEHHHHHHHHHcHHHHTcccTTHHHHHHHHHHHTTccEEEEEcTTHHHHHHHHHHHHHHTTccccccccEEEcccccccHHHHTcccccHHHHHHHTTccccHHHHHHGGGc############## DISOP:02AL 269-270, 273-277| PSIPRED ccEEEEEEEcccHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHccccEEEEcccccHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHcccccEEEEEEEEEccccccEEEcccccccccEEEEcccEEEcccccEEEEccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //