[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : lipA
DDBJ      :lipA         lipoic acid synthase
Swiss-Prot:LIPA_PELUB   RecName: Full=Lipoyl synthase;         EC=2.8.1.8;AltName: Full=Lipoic acid synthase;AltName: Full=Lipoate synthase;AltName: Full=Sulfur insertion protein lipA;AltName: Full=Lip-syn;         Short=LS;

Homologs  Archaea  20/68 : Bacteria  701/915 : Eukaryota  186/199 : Viruses  0/175   --->[See Alignment]
c.1.28c.92.1
:308 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   18->297 3cixA PDBj 7e-33 11.8 %
:RPS:SCOP  53->308 1qgoA  c.92.1.2 * 9e-30 11.2 %
:HMM:SCOP  38->305 1r30A_ c.1.28.1 * 2e-61 29.9 %
:HMM:PFM   74->233 PF04055 * Radical_SAM 6.6e-19 21.3 155/166  
:BLT:SWISS 1->308 LIPA_PELUB 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21753.1 GT:GENE lipA GT:PRODUCT lipoic acid synthase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 926637..927563 GB:FROM 926637 GB:TO 927563 GB:DIRECTION + GB:GENE lipA GB:PRODUCT lipoic acid synthase GB:PROTEIN_ID AAZ21753.1 GB:DB_XREF GI:71062750 GB:GENE:GENE lipA LENGTH 308 SQ:AASEQ MTTKPRHPEKVNKPLNPIKKKPDWIRSKLVNSKEFFLTKTIVNNNNLVTVCQEANCPNITECWSKRHATFMIMGDTCTRACAFCDVKTGRPGKLDSLEPVKIAEAVKKLNLKHVVITSVDRDDLDDGGSNHFFEVIDQTRKRNPNTSIEVLTPDFLRKGDAYKKVLEANPDVFNHNIETVPRLYLKVRPGSRYFSSLELLKNAKLVNKNVFTKSGLMVGLGENKEEIIQVMDDLKAADVDFLTIGQYLQPSVRHHPLDRYYHPDEFKELETIAKSKGFLLVSSTPLTRSSYHADEDFAKLQLNRINNH GT:EXON 1|1-308:0| SW:ID LIPA_PELUB SW:DE RecName: Full=Lipoyl synthase; EC=2.8.1.8;AltName: Full=Lipoic acid synthase;AltName: Full=Lipoate synthase;AltName: Full=Sulfur insertion protein lipA;AltName: Full=Lip-syn; Short=LS; SW:GN Name=lipA; OrderedLocusNames=SAR11_0941; SW:KW 4Fe-4S; Complete proteome; Cytoplasm; Iron; Iron-sulfur;Metal-binding; S-adenosyl-L-methionine; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->308|LIPA_PELUB|0.0|100.0|308/308| GO:SWS:NREP 5 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| RP:PDB:NREP 1 RP:PDB:REP 18->297|3cixA|7e-33|11.8|271/345| HM:PFM:NREP 1 HM:PFM:REP 74->233|PF04055|6.6e-19|21.3|155/166|Radical_SAM| RP:SCP:NREP 1 RP:SCP:REP 53->308|1qgoA|9e-30|11.2|240/257|c.92.1.2| HM:SCP:REP 38->305|1r30A_|2e-61|29.9|261/312|c.1.28.1|1/1|Radical SAM enzymes| OP:NHOMO 1072 OP:NHOMOORG 907 OP:PATTERN 11-----11111111---111---1111--11-----------------------------1------ 1121111111111111111-111111111111211111221112111111112221111111111111111-----------11-1111111-111-111111111111111111111111111111111111111111-1---21222222232222222222222222222222222222211111--11111111111111111111111111111111111------1111111111111111111111----------------------------------------------------------------------11---------------11--------11-------1-----111111--111111111111112111111111111111111111-11211111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111222222111112222111111222111111111121111111111111111111111111111111--1-1--11-2111-111111112111111-11---------------------111111111111111111111111111111111111-1111111111111111111111111111-11211111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111112222212111111111111111211111111111111111111111111111111111111111111111-111111--------1-------------------------------------111 11----1-311-1111111-111111111111111111111111111111111111111111111111-1111111111111111111-12111111111111112-1312121111111111121121382-31311111-12-1111111111211112111211111A11222222Q2222223351222211113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 280 STR:RPRED 90.9 SQ:SECSTR #################HHHHHHHHHTTcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEcccccccTTcTTcTTccccccHHHHHHHHHHHHHTTccEEEEEEcccGGGTTcccHHHHHHHHHHHTTccEEEEEcccccHcccHHHHHHHHHTTccEEEcccccccHHHHHHHTTccHHHHHHHHHHHHTTTTcEEEEccEEccTTccHHHHHHHHHHHHHHTccEEccEEccccTTcTTTTcccccHHHHHHHHHHHHHHcTTccccccHHHHHHcTTHHH########### DISOP:02AL 1-5, 8-23, 304-308| PSIPRED ccccccccccccccccccccccHHHEEcccccHHHHHHHHHHHHccccEEEEcccccccHHcccccEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHccccEEEEccHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccEEEcccccHHHHHHHHHHHHHccccEEEccccccccccccccHHcccccHHHHHHHHHHHccHHHccccccHHHHHHHHHHHHHHHHHHHccc //