[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : livF
DDBJ      :livF         ATP-binding protein of branched-chain amino acid ABC transporter
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:235 amino acids
:PSIPRED
:BLT:PDB   20->234 1ji0A PDBj 4e-41 44.9 %
:RPS:PDB   4->51 2c9gA PDBj 1e-07 4.4 %
:RPS:PDB   31->227 2ccgA PDBj 1e-36 8.4 %
:RPS:SCOP  4->235 1b0uA  c.37.1.12 * 8e-42 24.9 %
:HMM:SCOP  13->236 1ji0A_ c.37.1.12 * 1.4e-56 38.4 %
:RPS:PFM   44->164 PF00005 * ABC_tran 3e-14 39.3 %
:HMM:PFM   44->164 PF00005 * ABC_tran 6e-23 36.4 118/118  
:HMM:PFM   19->50 PF00488 * MutS_V 5.2e-05 28.1 32/234  
:BLT:SWISS 8->235 LIVF_SALTY 9e-54 44.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22154.1 GT:GENE livF GT:PRODUCT ATP-binding protein of branched-chain amino acid ABC transporter GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1287906..1288613) GB:FROM 1287906 GB:TO 1288613 GB:DIRECTION - GB:GENE livF GB:PRODUCT ATP-binding protein of branched-chain amino acid ABC transporter GB:PROTEIN_ID AAZ22154.1 GB:DB_XREF GI:71063151 GB:GENE:GENE livF LENGTH 235 SQ:AASEQ MAFFEGLKMTGGYGNGPDIINSCSVNVNRGEIVSILGPNGAGKSTAMKAMLGLLNLKSGSVIIDGKDISKLSPQDRVREGISFVPQTKNVFSGMSVEENLEMGAYLRDDNYQNIIEEIYELFPILREKRNQLVGELSGGQRQQVALGRALMIKPSVLMLDEPTAGVSPIVMDELFDHIIKVKRTNVAILMVEQNAKQALNISDRGYVLVTGENKYSGTGKELLNDPRVRSSFLGG GT:EXON 1|1-235:0| BL:SWS:NREP 1 BL:SWS:REP 8->235|LIVF_SALTY|9e-54|44.9|227/237| BL:PDB:NREP 1 BL:PDB:REP 20->234|1ji0A|4e-41|44.9|207/231| RP:PDB:NREP 2 RP:PDB:REP 4->51|2c9gA|1e-07|4.4|45/447| RP:PDB:REP 31->227|2ccgA|1e-36|8.4|190/202| RP:PFM:NREP 1 RP:PFM:REP 44->164|PF00005|3e-14|39.3|117/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 44->164|PF00005|6e-23|36.4|118/118|ABC_tran| HM:PFM:REP 19->50|PF00488|5.2e-05|28.1|32/234|MutS_V| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 4->235|1b0uA|8e-42|24.9|229/258|c.37.1.12| HM:SCP:REP 13->236|1ji0A_|1.4e-56|38.4|224/0|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 51209 OP:NHOMOORG 1174 OP:PATTERN VUK8SKIKYXXTZSaOpISSMROb*OTilYgXJDEFGCJIJFERXNXmMR**h9QbQWXOTMLFZ179 RZuJ*aehssuWcSZRQSR-RgCCa*SSSSSQpjilt***W*W*t*qfsfXP*zyROgEEuw*i*qx***eWWWWwbZbQ*kmCCB9CSRTO7LGLK--GHTMMMfRbRR7888888789BBBBFTRKUYQMTXbUmrrw*LLM*cuoovffmZcUUMHMKNJhhbk***cMUIPKJKUINJJjaZURuk9Wf*************************gs***juy**xwz**bhhijifgggiihggYhdZf*lce**dQicp**QQ**gaTcknhkkqquyuq****vxuvrpvzrvwbbdcabcdgdcaa*uvffhwvzpu***********k*px***fool*wj***otQK**vkaejnUanfquQbcXPeVSSLJMKJNaV***cVu****************-rt*mh*p***RB**************LJM**********XWXXXXXXxZcHTna*886777776578A9BD9ABB9A99AA7C7LDDGAD***********zwvxr********k********CQ**x*mrjn******anqNYIUmUHIJJLJJQTQXomc**QdYudYgybYlKeZbRTYjTYXZTYszY*MKMVGKJKLIE8BCCCCCDCJTGGMNMojuTsYgKUM*RVYZWQWgXVVVXYeaXdb5-FLRPM321333*w**W*zx***y***vw-*xwx*w*zy****tvwvuu*****mojqqoporrsrqoqsqpn*rnpttrsR7************34JJDGDDEOPRPOI*k*ZZYbZWHQSNNRPUhPRTRRIWIQVtguvutv***r**yxj***FDECEEEDDMirp*sstts*****RSPNPONLNOFDDD88NTRQMMKL89888888*CbBAABD-FCEAIEALKHAEMAAEAABZm*WXm*osmEdQ 2266kiO-aH8HXkXLNMFIPVOZLWQHHDECEPPOENJKIJIFDEMJNXWPdXNOMFIFIIJDF77A2AC6CCG9E39D9AA9CC66-PaANJFHCBBGH6FPHD9Upu*dmfzpvPLJKNbQ**G*I**y4*Z*PQNHnLO*hHSMIFiJF*LhVXzOs*W*ViI*gu*sm*ZGONF*AHGMO*on*F**OM****X ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ PSIPRED ccEEEEEEEEEEEcccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHcccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHcHHHHHHHccc //