[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : livG
DDBJ      :livG         ATP-binding protein of ABC transporter
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  904/915 : Eukaryota  145/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:264 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   7->255 1g9xA PDBj 1e-45 40.2 %
:RPS:PDB   7->255 2d3wB PDBj 1e-32 19.9 %
:RPS:SCOP  6->255 1b0uA  c.37.1.12 * 1e-36 20.2 %
:HMM:SCOP  4->260 1g6hA_ c.37.1.12 * 2.6e-56 33.5 %
:RPS:PFM   47->181 PF00005 * ABC_tran 7e-08 32.5 %
:HMM:PFM   47->181 PF00005 * ABC_tran 4.1e-20 33.3 114/118  
:HMM:PFM   234->255 PF12399 * BCA_ABC_TP_C 1.1e-07 59.1 22/23  
:HMM:PFM   25->59 PF00006 * ATP-synt_ab 0.00075 34.3 35/215  
:BLT:SWISS 7->255 LIVG_ARCFU 1e-46 40.8 %
:PROS 156->170|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22155.1 GT:GENE livG GT:PRODUCT ATP-binding protein of ABC transporter GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1288613..1289407) GB:FROM 1288613 GB:TO 1289407 GB:DIRECTION - GB:GENE livG GB:PRODUCT ATP-binding protein of ABC transporter GB:PROTEIN_ID AAZ22155.1 GB:DB_XREF GI:71063152 GB:GENE:GENE livG LENGTH 264 SQ:AASEQ MDQEQNILQIENLSKYFGGLAAVSDCSLKIKKGSITGIIGPNGSGKTTLFNLIAGNLKSSQGKVLFNNEDVTDVPSYELFSKGILRTFQIAHEFTNLSVLENLMMVPANQSGENLMTALLKPSLVRTEELKVKQKAQDVVDFLNLTHLSNELAGNLSGGQKKLLELGRTMMVDAKLVLLDEVGAGVNRTLLKDLGTAILKLNKEEGYTFCMIEHDMEFISRLCNPVIVMAEGSVLFEGTAEEAKKDEKVIESYLGRGSKIKDEN GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 7->255|LIVG_ARCFU|1e-46|40.8|245/257| PROS 156->170|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 29->40|kikkgsitgiig| BL:PDB:NREP 1 BL:PDB:REP 7->255|1g9xA|1e-45|40.2|246/253| RP:PDB:NREP 1 RP:PDB:REP 7->255|2d3wB|1e-32|19.9|241/244| RP:PFM:NREP 1 RP:PFM:REP 47->181|PF00005|7e-08|32.5|117/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 47->181|PF00005|4.1e-20|33.3|114/118|ABC_tran| HM:PFM:REP 234->255|PF12399|1.1e-07|59.1|22/23|BCA_ABC_TP_C| HM:PFM:REP 25->59|PF00006|0.00075|34.3|35/215|ATP-synt_ab| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 6->255|1b0uA|1e-36|20.2|248/258|c.37.1.12| HM:SCP:REP 4->260|1g6hA_|2.6e-56|33.5|254/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 22972 OP:NHOMOORG 1117 OP:PATTERN DD83HB69GECDHBFFQ7FGACELX57HQ6JGA45AB77A869DJDDN9GmVS6CJDIIHGBA9H123 7BE6bB9IKKJBC7A9666-6F338d666665IMMMGhde8S9XGBCDGFC7PLP97I55GFWEJLOcUUIGDCCKEED8MCM54658BBCA4A6761-79DAD9HAD7E2222222434333379A59E95AHEAEGGNO998UIHHIMFEKFLEE828365ILJGVTUE96798678A96ARHKIFMM6BMbpppmpov*ctvqtrxfbSSVVtstPWYleNTPRRPOQ*mGMMLMLMKMMMMMMMKIIJCYMEGROGEMGPVWCBSTLJEIRMKMKRPRSSNVOWUSSRXOPRWRUSIHHHHIJJIIIHJSNOIFHPPQQSsYrumnmstwqUsURmjkMQQOoSUVNZHRE9qsRQNPLLCFPIJRBNL7HD9777ABBABID***HBXyhv*hilimjhnfhh*-IOsKEvKet*B5**************989gm*gkhlydw66666666WAC48SAR11122222222244334454424443131F44895f**iuminjqqWPRRPgg**WUUUNXsg*epqf6EacWcTUOTsl*z**IRO5C8BJDBBA999ACABESSHj*FOMbMLPTIKTEJEJDHKHD8DDCBMLJjBAAEBBBBCBA4345544448C85765RRbAQEF7AAhADDEC8DHABBDFBEDEHD4-885682-----pbqkFjUbeeccdZeaa-eZabbadbabfecZZaZZcu*wnuRSKTSQQSSSTSSRPSPQRvVTSYZXYE4hppppqqnoqqr23B79A89ACCCC8AZS*MMLQSNDGIFGIHLREEFDE8H7CEOETSQTRkjvTaXWVMnki999787999AMTSWMNMMNUYWRQAAA9A999997787226GCCABAB56554454f4H74743-2341585886337554222JQREGKfLPL8EC --11BB3-42-336422--2223223-11----11211-1--11112212--4-1-31122221---1-1---2--1-11-11-11----21211-------1----61784569323-1--7-DC27-9X7-737321-6117224211621R1543H34G55451E69G66831233711-14A43K-9211GCFD5 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 261-264| PSIPRED ccccccEEEEEcEEEEEccEEEEccccEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHcccccccccccccccccHHHHHHHHHHHHccccHHHHHHccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHcEEEEEEccEEEEEccHHHHHccHHHHHHHcccccEEcccc //