[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : livG2
DDBJ      :livG2        ATP-binding protein of ABC transporter natA
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:246 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   1->244 1gajA PDBj 2e-41 37.4 %
:RPS:PDB   3->244 2d3wB PDBj 9e-37 16.7 %
:RPS:SCOP  3->246 1b0uA  c.37.1.12 * 9e-41 22.2 %
:HMM:SCOP  3->244 1g6hA_ c.37.1.12 * 2.1e-56 32.0 %
:RPS:PFM   3->72 PF00154 * RecA 7e-04 30.4 %
:RPS:PFM   30->50 PF03205 * MobB 3e-04 57.1 %
:RPS:PFM   77->173 PF00005 * ABC_tran 3e-06 38.5 %
:RPS:PFM   222->244 PF12399 * BCA_ABC_TP_C 8e-05 56.5 %
:HMM:PFM   43->173 PF00005 * ABC_tran 8.9e-20 29.9 117/118  
:HMM:PFM   222->244 PF12399 * BCA_ABC_TP_C 3.1e-11 56.5 23/23  
:HMM:PFM   29->49 PF02463 * SMC_N 5.9e-05 42.9 21/220  
:BLT:SWISS 3->244 LIVG_SALTY 9e-49 37.2 %
:PROS 145->159|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22161.1 GT:GENE livG2 GT:PRODUCT ATP-binding protein of ABC transporter natA GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1292926..1293666) GB:FROM 1292926 GB:TO 1293666 GB:DIRECTION - GB:GENE livG2 GB:PRODUCT ATP-binding protein of ABC transporter natA GB:PROTEIN_ID AAZ22161.1 GB:DB_XREF GI:71063158 GB:GENE:GENE livG2 LENGTH 246 SQ:AASEQ MAILDISNVSKSFGGVKANVDISMSVEQGSIVGLIGPNGSGKTTLFNSIVGTYPIDGGSIKFNNREVSELPVPVIAKLGLLRTFQQTRIYGKLNCIQNMLISHKPENDGILTVFQKIPSGLTDKAETLLKFVGLHQKRKLRAGDLSFGQQKLLELAMALMNEPKMLLLDEPTAGINPTLINGIIDRLISVNKDYGITLLVIEHNMKVIMNLAQRVFCLAHGQMLANGTPDEIKNDKRVLDAYLGAQ GT:EXON 1|1-246:0| BL:SWS:NREP 1 BL:SWS:REP 3->244|LIVG_SALTY|9e-49|37.2|242/255| PROS 145->159|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 1->244|1gajA|2e-41|37.4|243/253| RP:PDB:NREP 1 RP:PDB:REP 3->244|2d3wB|9e-37|16.7|240/244| RP:PFM:NREP 4 RP:PFM:REP 3->72|PF00154|7e-04|30.4|69/274|RecA| RP:PFM:REP 30->50|PF03205|3e-04|57.1|21/139|MobB| RP:PFM:REP 77->173|PF00005|3e-06|38.5|91/123|ABC_tran| RP:PFM:REP 222->244|PF12399|8e-05|56.5|23/23|BCA_ABC_TP_C| HM:PFM:NREP 3 HM:PFM:REP 43->173|PF00005|8.9e-20|29.9|117/118|ABC_tran| HM:PFM:REP 222->244|PF12399|3.1e-11|56.5|23/23|BCA_ABC_TP_C| HM:PFM:REP 29->49|PF02463|5.9e-05|42.9|21/220|SMC_N| GO:PFM:NREP 7 GO:PFM GO:0003697|"GO:single-stranded DNA binding"|PF00154|IPR013765| GO:PFM GO:0005524|"GO:ATP binding"|PF00154|IPR013765| GO:PFM GO:0006281|"GO:DNA repair"|PF00154|IPR013765| GO:PFM GO:0005525|"GO:GTP binding"|PF03205|IPR004435| GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF03205|IPR004435| GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 3->246|1b0uA|9e-41|22.2|243/258|c.37.1.12| HM:SCP:REP 3->244|1g6hA_|2.1e-56|32.0|241/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 39810 OP:NHOMOORG 1171 OP:PATTERN ONF7KIIFSRRPSNWKfEMNHLJWsILWcMXRHAEDEBGEGDCPXNUfMQ*tc8MXPPTLLIGCS16A LSbI*SPUcchLVIMIFHG-GT77O*IIIIIGjaZcf***QsQxergVfXRKtmqFFX99gg*Opdk***UUOOOhWUYLhXeB768BONLF4ICEE--DGPJKHXITCQ57777679987777FRPFMRMFPSXMegflqLJJxVgafmaaeXcQRHFHACCXZRZqutXGIELFFHKGIDHdSUPOhZ9Lfs********v********vvqu***aln*zemmlmhik**UZZbbaYXZZZZZZZWVQYXtXUVttXQTTdqnPPy*ZSOTefaedljolheiqonsursmlnvprsTTTTSUVUUVUTUulkXWVlkngf*n*********h*gr***ZZbb*lfpn*bpPI**jcTZfgRScUkiOUYLKXQKKHFIHHIWP***TFg****************-Vd*VO*Y***I8**************FFIy*******y*IIIIIIIIuSWCNcR*88535333535668AA86646877894A5KA8A9B***********prrto*****xyyh*******z9Ltrm*gjej******UicFRHMbPGGHGGGGKOKWghXy*NaTqfScrSSdFaRXNPRZRTVWRWgnXwLCHOGHGGIDE468667867DMDDIJIiinJpRUJOGqNRTUSKOXOOPNNSXRQVU6-AHKMI311222*l**O*nkppklmimmk-pjjnjimojmqljihjihn*****beZhfefghhhhhfehefg*gcahhfhL4z***********23GEEFDEFKLMKHJye*WVVVWTHKOJLQNTULMOMMERGLSeWpojpm***fvvqqe***GEECEFFFEIbgerjkkkkv*rtrMLGJEJJHIIB9A945DQPPHIII78776878*CYA897A-98A8BF9HGG8CG8AA777ZgoTRd*dhaDYJ --11OQ8-KB39AIBA69557A77798873413DC9478756743455AD98CA8993886553635334235345411426324631-4F266665755313D8616KSLEFJSHFA771BGCZb4P6s*T2SEOB9B6M69MF7E857J88*8LFCcDO*COGU6bEQ*NOKD7594*32468WFGw5XNACSDORA ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 246-247| PSIPRED ccEEEEEcEEEEEccEEEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHcccccccccccccccccHHHHHHHHHHccccccHHHHcccHHHHHHHHHHHHHHcccHHHHccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHccHHHHHHHcccc //