[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : livH2
DDBJ      :livH2        probable high-affinity branched-chain amino acid transport permease protein
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  345/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.52.1
:286 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  186->246 1hd5A  b.52.1.1 * 1e-04 34.6 %
:RPS:PFM   21->271 PF02653 * BPD_transp_2 6e-09 22.3 %
:HMM:PFM   8->272 PF02653 * BPD_transp_2 5.8e-35 22.7 255/267  
:BLT:SWISS 21->272 LIVH_SALTY 1e-18 24.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22163.1 GT:GENE livH2 GT:PRODUCT probable high-affinity branched-chain amino acid transport permease protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1294718..1295578) GB:FROM 1294718 GB:TO 1295578 GB:DIRECTION - GB:GENE livH2 GB:PRODUCT probable high-affinity branched-chain amino acid transport permease protein GB:PROTEIN_ID AAZ22163.1 GB:DB_XREF GI:71063160 GB:GENE:GENE livH2 LENGTH 286 SQ:AASEQ MVQASMDGILLGILFALIAYGMALQWGVMNIINIAQGELVIMGGYIAYFMYLSGIHPAFGIIVSPIVMYCVGWGMYKLVINKVVDKDLFTSILATFGISILAQQLMNFAFGADVVVAQSDFGTTMLFNDMVTIPNAKLFSGAVCVISAFILVIYMRKSKLGRAIRATAQNARAAKILGVDTEKVYAATFGINAALCGIAGACVAITFTLHPYTGLPYTVRSFMIVIIAGLGNLPAVAISGMGLGIFEEWADYLLGTEFRIAAVFSLLVLILVYRRFKLSRKREYLK GT:EXON 1|1-286:0| BL:SWS:NREP 1 BL:SWS:REP 21->272|LIVH_SALTY|1e-18|24.4|246/308| TM:NTM 8 TM:REGION 1->23| TM:REGION 27->49| TM:REGION 53->75| TM:REGION 93->115| TM:REGION 134->155| TM:REGION 186->207| TM:REGION 220->242| TM:REGION 252->273| SEG 8->19|gillgilfalia| SEG 162->174|rairataqnaraa| RP:PFM:NREP 1 RP:PFM:REP 21->271|PF02653|6e-09|22.3|247/271|BPD_transp_2| HM:PFM:NREP 1 HM:PFM:REP 8->272|PF02653|5.8e-35|22.7|255/267|BPD_transp_2| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF02653|IPR001851| GO:PFM GO:0006810|"GO:transport"|PF02653|IPR001851| GO:PFM GO:0016020|"GO:membrane"|PF02653|IPR001851| RP:SCP:NREP 1 RP:SCP:REP 186->246|1hd5A|1e-04|34.6|52/205|b.52.1.1| OP:NHOMO 602 OP:NHOMOORG 358 OP:PATTERN 11----------------11-11-1---2-22---------------1----------------1--- -------1111----------1---1------1111-111----------------------2---11---1---1111-------------1------------11--------------------1-----1-------111-1-------11--------1-1-111-------------21---11--------------------1--------421---------22------------------------11-----11--------------------1------------------------------------12--31111111-1---11----2-1------211-122---1---1111-1----------1-7671-17389422332232321-12311413131-433312233133371--1-311113-3222222222---1412-----------------------------2-----643341234421----44211111-13564453--11-2-111223259111-1-11-----------11114511-1-22-112-1-1-111--1211-1131--1-----------------------1121311---1------1--------1-1-----1-1------1112-211111111111-11111111111111111113331111-111111111111111121111111--111111111111--------------1212-------------------------222212211111111-312--------------------1-------------------2-------------------------------------------2-2---1111-1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 281-286| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEccccEEHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccccc //