[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : livJ
DDBJ      :livJ         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  370/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:394 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   22->342 2lbpA PDBj 5e-22 27.6 %
:RPS:PDB   21->228 1dp4C PDBj 9e-21 14.5 %
:RPS:SCOP  22->327 1usgA  c.93.1.1 * 1e-37 25.6 %
:HMM:SCOP  21->387 1ewkA_ c.93.1.1 * 1.4e-56 29.2 %
:RPS:PFM   45->224 PF01094 * ANF_receptor 7e-19 38.4 %
:HMM:PFM   43->366 PF01094 * ANF_receptor 2e-33 27.5 306/348  
:BLT:SWISS 22->341 LIVB3_BRUME 4e-26 32.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22149.1 GT:GENE livJ GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1282283..1283467 GB:FROM 1282283 GB:TO 1283467 GB:DIRECTION + GB:GENE livJ GB:PRODUCT hypothetical protein GB:NOTE similar to COG0683: ABC-type branched-chain amino acid transport systems, periplasmic component GB:PROTEIN_ID AAZ22149.1 GB:DB_XREF GI:71063146 GB:GENE:GENE livJ LENGTH 394 SQ:AASEQ MKKLFIAAFIFVSTFTTNTFAEVKMGIILGFTGPIESLTPAMAASAELAFKEASDSGSLLGGETISVVRADSTCVDSAAATAAAEGVIAQGVAAIMGADCSGVTGAIASNVAVPNGVVMISPSATSPGLTALDDKGFFFRTAPSDARGGQILADITKDRKIKSVAITYTNNDYGKGLADVYEAAVKAHGIKVTTVSAHEDGKADYSSEVATLASAGGDAVAVIGYLDQGGKGIIQGSLDSGAFDKFILSDGMIGDSLTEAFGKDLNKSFGSIPGSMNKKTAGTFASVAKAAGIDSSGPYTGESYDAAALIVLAMQAGGSADRASIAKNVMDVANAPGTKIYPGELKKGLDLLAKGKKVDYEGATGVTFTNVGEAEGSFLEKEIKGGKFKNKKQR GT:EXON 1|1-394:0| BL:SWS:NREP 1 BL:SWS:REP 22->341|LIVB3_BRUME|4e-26|32.9|301/368| SEG 78->84|aaataaa| SEG 343->357|gelkkgldllakgkk| SEG 380->392|ekeikggkfknkk| BL:PDB:NREP 1 BL:PDB:REP 22->342|2lbpA|5e-22|27.6|312/346| RP:PDB:NREP 1 RP:PDB:REP 21->228|1dp4C|9e-21|14.5|207/429| RP:PFM:NREP 1 RP:PFM:REP 45->224|PF01094|7e-19|38.4|177/319|ANF_receptor| HM:PFM:NREP 1 HM:PFM:REP 43->366|PF01094|2e-33|27.5|306/348|ANF_receptor| RP:SCP:NREP 1 RP:SCP:REP 22->327|1usgA|1e-37|25.6|301/345|c.93.1.1| HM:SCP:REP 21->387|1ewkA_|1.4e-56|29.2|353/0|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 795 OP:NHOMOORG 394 OP:PATTERN 11---1--11--1-1-2-2221213--14-11----1----------------------1----2-1- --------------1----------------------111122111---11-111--1--321-11-1--21222---1---1-----------------------------------------------1--1--1--11---2-21111111111------11-1111-------------21---11-----------------------------111-----------------------------------11-----11--11---11-------1---11111111111111--------------11111111111--21111111-1---------1----2--23112232--11---2-12-------------14321121112145344542443-215215-313--32223354221222---2111111111--------1----123-----------------------------1-----26635B8A8AA4333299B64444259962222-222221122174335231----43----------222132--12232222211-1--2---22223-14---1-----------------1-----111-1--------------------------------------3121-312222222222-22222222222222222223331111-2222222222212121222222221-111111111111---------------211-------------------------2-22222322122221222----------------------------------------1-------------------------------------------1----1-111-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 322 STR:RPRED 81.7 SQ:SECSTR ####################cEEEEEEEEcccccccTTHHHHHHHHHHHHHHHHTcTTccTTcEEEEEEEEccccTTHHHHHHHHHHHHHcccEEEccccHHHHHHHHHHHHHHHTccEEEcccccGGGGcTTTcTTEEEccccHHHHHHHHHHHHHHHTcccEEEEEEcccTTcccHHHHHHHHHHHHHHHHEEEEccTTcTTHHHHHHHHHHHHccEEEEEccHHHHHHHHHHHHHHTTcTTTcEEEEcTTTTTccGGGcccHHHHTTcEEEEEcccccHHHHHHHHHTTGTcHHHHHHHHHHHHHHHHTHHHHccHHHHHHHHHcccccTTccccccEE#################################################### PSIPRED cHHHHHHHHHHHHHccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEccccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHcccEEEEEEccccHHcccccccEEEEEcccHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHccEEEEEEccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccEEEEcccccccccEEEEEEEccEEEEEEcc //