[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : livJ2
DDBJ      :livJ2        Leu/Ile/Val-binding protein precursor
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  381/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:413 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->389 2lbpA PDBj 1e-15 23.5 %
:RPS:PDB   33->385 3eafA PDBj 2e-29 15.7 %
:RPS:SCOP  31->387 1usgA  c.93.1.1 * 4e-48 20.8 %
:HMM:SCOP  32->412 1qo0A_ c.93.1.1 * 3.4e-67 27.3 %
:RPS:PFM   53->349 PF01094 * ANF_receptor 5e-25 33.6 %
:HMM:PFM   53->372 PF01094 * ANF_receptor 4.1e-23 16.6 313/348  
:BLT:SWISS 21->413 LIVB5_BRUME 4e-59 32.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22164.1 GT:GENE livJ2 GT:PRODUCT Leu/Ile/Val-binding protein precursor GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1295676..1296917) GB:FROM 1295676 GB:TO 1296917 GB:DIRECTION - GB:GENE livJ2 GB:PRODUCT Leu/Ile/Val-binding protein precursor GB:PROTEIN_ID AAZ22164.1 GB:DB_XREF GI:71063161 GB:GENE:GENE livJ2 LENGTH 413 SQ:AASEQ MKIRNIIITLVSAIALLISASTISFAKVVGDKIILGAAISLTGKYSSNGVHTQNGYNLAVDRINDMGGIKVGGKTYKFEIIYYDDESNSGRAAQLAERLIQQDGVQYMLGPYSSGLTKAMAPVTEKYGIPMVEANGASRSLFTKGYKYLFAVLAPANLYLDVAIDLAVEKNGGKPVKIAMAFEQDAFSQDVRLGILDAAKRTGSKIIIDDKLPKELNDMAATLSKVKAVKPDVLVVSGHTKGALTAVRQISEMKVDVPMLAMTHCDAAKLSKMHGKASEYALCASQWHKSLSYKDDFFKDGTTYDADFTKAFGYAPPYQAAESSAALLVFKDAFERAQSFDTKKVRDALAATDMQTFYGNIKFAEGGQNVSKPMVLFQVSCNDDGSKCENKVVAPTKWASAELVHPIPSWSKR GT:EXON 1|1-413:0| BL:SWS:NREP 1 BL:SWS:REP 21->413|LIVB5_BRUME|4e-59|32.2|385/406| TM:NTM 1 TM:REGION 13->35| BL:PDB:NREP 1 BL:PDB:REP 31->389|2lbpA|1e-15|23.5|344/346| RP:PDB:NREP 1 RP:PDB:REP 33->385|3eafA|2e-29|15.7|343/379| RP:PFM:NREP 1 RP:PFM:REP 53->349|PF01094|5e-25|33.6|283/319|ANF_receptor| HM:PFM:NREP 1 HM:PFM:REP 53->372|PF01094|4.1e-23|16.6|313/348|ANF_receptor| RP:SCP:NREP 1 RP:SCP:REP 31->387|1usgA|4e-48|20.8|342/345|c.93.1.1| HM:SCP:REP 32->412|1qo0A_|3.4e-67|27.3|362/0|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 1077 OP:NHOMOORG 400 OP:PATTERN 11----------------111111----3-12-------------1-2----------------2--- -------1111----------2---2------1212-11111--1-----------------3-1-11--1----211----1--------------------------------------------1-11--3--11111---22--11----1--2111-1--11----11-11111-1-12212111---------------------------1-3311--------32------------------------11-----11--11---11-----------111------------------------111111111121--21111111-1---------1----4--42113262--11---2112-1-----------1E771-25466344354542435-11B21A282-1-4221224331328D---1-1-111211111111114----7-2-----------------------------2-----7EC9CBADBDB45554BBD8666645DBB6764-2224525447747AF343----43----------4461781318238533323232143-13323211C---------------------1-----111-2--------------------------------------2-3--312222222222-22222222222222222224441111-111111111111211-322222221-111111111111---------------2-1-------------------------2-211213-1211131111----------------------------------------1---------------1---------------------------1-2--13111-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------1--------2--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 389 STR:RPRED 94.2 SQ:SECSTR ccEEEEEEEEEEEEEEEETTEEEEEEEEEccEEEEEEEEccccTTHHHHHHHHHHHHHHHHHHHHHcEEcTTccEEEEEEEEEEcTTcHHHHHHHHHHHHHTTcccEEEEccHHHHHHHHHHHHHHHTcEEEEccccGGGTGcTTcTTEEcccccHHHHHHHHHHHHHHHHccEEcEEEEEcTTcHHHHTTHHHHHHHTGGGTEEEEEEEEccTccHHHHHHHHHHHTTcccEEEEEcccHHHHHHHHHHHHHTcccEEEcGGGccTTHHHHHcGGGTTcEEEEEccccGGcTTcHHHHHHHHHHHHHTTccGGGccHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHcccccccccTTcccccccEEEEEEcTcTTcEEcc######################## DISOP:02AL 1-4, 412-413| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccccccccccccccEEEEcccHHHHHHHHHHHHHHHccccEEEEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHccccEEEEEEEccccHHHHHcccHHHccEEEEEEccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccEEEEEEccccccccccEEEEEEEEccccEEEEEEEEcccccccccccccccccccc //