[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : livM
DDBJ      :livM         Branched-chain amino acid transport system/permease component
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  63/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:443 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   290->372 PF02653 * BPD_transp_2 6e-08 42.0 %
:HMM:PFM   20->127 PF02653 * BPD_transp_2 6.7e-05 21.6 102/267  
:HMM:PFM   144->380 PF02653 * BPD_transp_2 4.6e-30 27.6 192/267  
:BLT:SWISS 283->372 LIVM_METJA 4e-08 26.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22152.1 GT:GENE livM GT:PRODUCT Branched-chain amino acid transport system/permease component GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1285527..1286858) GB:FROM 1285527 GB:TO 1286858 GB:DIRECTION - GB:GENE livM GB:PRODUCT Branched-chain amino acid transport system/permease component GB:PROTEIN_ID AAZ22152.1 GB:DB_XREF GI:71063149 GB:GENE:GENE livM LENGTH 443 SQ:AASEQ MLGLIILVGIFQSWNVALSIFNMCLISAVMTMGANIQWGYAGLINFGLMGYAALGGLAAVLISVEPVQEAWVAGGFSILMSLWLIVAMVLAIRFVLKNFEKSKIRTYGIATIIIAGIIIIRVTSETSIEAIENVNPATTGFLGGLGLPIMFSWIVGAFFAAGLAFIVGKVALGLRADYLAIATLLISEIVIAIIKHEDWLTRGVKNVIGLDRPVPYEIELQTKEWFINLVAKFNSGKLDLISSITDKQSALNQLVIEGSSVFVKLCYSGLFLIVVIALLIVTQKALYSPWGRMMRAIRDNEEAANAMGKNVVKQHLLIFILGSAIVGIAGAMLVTQDGLFTPGSYQPMRYTFLIWVMVIVGGSGNNFGAILGGFAVWFLWIEAAPIALFLINLFTAGLADTHSLKIHLIESVPYFRYLMMGMGLLLIMRYRPKGILPEKIEIK GT:EXON 1|1-443:0| BL:SWS:NREP 1 BL:SWS:REP 283->372|LIVM_METJA|4e-08|26.7|90/345| TM:NTM 11 TM:REGION 7->29| TM:REGION 43->65| TM:REGION 74->96| TM:REGION 105->127| TM:REGION 143->165| TM:REGION 177->199| TM:REGION 260->282| TM:REGION 313->335| TM:REGION 339->361| TM:REGION 373->395| TM:REGION 410->431| SEG 47->61|glmgyaalgglaavl| SEG 104->121|irtygiatiiiagiiiir| SEG 272->281|livvialliv| SEG 418->428|lmmgmglllim| RP:PFM:NREP 1 RP:PFM:REP 290->372|PF02653|6e-08|42.0|81/271|BPD_transp_2| HM:PFM:NREP 2 HM:PFM:REP 20->127|PF02653|6.7e-05|21.6|102/267|BPD_transp_2| HM:PFM:REP 144->380|PF02653|4.6e-30|27.6|192/267|BPD_transp_2| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF02653|IPR001851| GO:PFM GO:0006810|"GO:transport"|PF02653|IPR001851| GO:PFM GO:0016020|"GO:membrane"|PF02653|IPR001851| OP:NHOMO 88 OP:NHOMOORG 74 OP:PATTERN --------11--1---2---11--2---4-21--------------------------------1--- ---1---------------------1----------11------1-------------------------1---------------------------------------------------------------------------11111111111------111-111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1---2-------1111----1---2112122112---------------------------------------------1-----1----------1------1---------11--1--11----------1--2-------------------1-----------------------------1--1----------------------------1--1----1----------------------------------------------------------------------------------------------------------------------------------121--------------------------1--------1--------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 440-443| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHEEEEEcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccHHccc //