[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : lnt
DDBJ      :lnt          apolipoprotein N-acyltransferase (copper homeostasis protein)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  494/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.160.1
:514 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   317->491 3c8wB PDBj 1e-23 13.7 %
:RPS:SCOP  227->461 1erzA  d.160.1.2 * 1e-18 13.1 %
:HMM:SCOP  219->461 1f89A_ d.160.1.1 * 4.3e-21 22.2 %
:HMM:PFM   298->411 PF00795 * CN_hydrolase 3.4e-11 25.0 92/184  
:BLT:SWISS 69->476 LNT_RHILO 6e-50 29.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21207.1 GT:GENE lnt GT:PRODUCT apolipoprotein N-acyltransferase (copper homeostasis protein) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 375981..377525 GB:FROM 375981 GB:TO 377525 GB:DIRECTION + GB:GENE lnt GB:PRODUCT apolipoprotein N-acyltransferase (copper homeostasis protein) GB:PROTEIN_ID AAZ21207.1 GB:DB_XREF GI:71062204 GB:GENE:GENE lnt LENGTH 514 SQ:AASEQ MLKKNFLNILYVFFLGAISSYSLPPYNYFIINFFTFSLFFIFLFTQKKNNPNNKSFFKYGWFFGFGYFLCSLYWIAISLTFDESFKFLIPIAIVLFPAFLAIFYGLITYLFSVFYSRDVVSTFFIFSILFGSIEFIRGSILTGFPWNLIAFSFSESIYFIQILSVIGTYSFNLICISLFTVPAVFILRKTRKEIIVCFFFIIISVGFLVFGNLKYNQFNTTADIKNNFTIRAVSPNISLDRFYSKQDELKIIQELITLSSPEKKEPMIFLWPEGIIPDSYLRDMDIYKELFSNSFSSDDLIIMGLNSVKTKNNENLFFNSMAIFNNKLDLIHSYNKNNLVPFGEFTPFESVLSLIGLKTVTNDYQSFSKGENQKALLIKNDKIELKLLPLICYEIIYSNRLFKDKNFDYIINISEDGWFGNSIGPKQHFAHSIFRSIESGKYVIRSANNGISAIVNPIGIIEKKVEFGTIGYVDFKESKILKSTPYMNYGDKIFFILILLYIFLIFSFKKIIDE GT:EXON 1|1-514:0| BL:SWS:NREP 1 BL:SWS:REP 69->476|LNT_RHILO|6e-50|29.9|398/530| TM:NTM 8 TM:REGION 15->37| TM:REGION 58->80| TM:REGION 88->110| TM:REGION 118->140| TM:REGION 144->166| TM:REGION 169->187| TM:REGION 193->215| TM:REGION 487->508| SEG 29->45|fiinfftfslffiflft| SEG 47->68|kknnpnnksffkygwffgfgyf| SEG 194->203|iivcfffiii| SEG 492->512|kiffilillyiflifsfkkii| RP:PDB:NREP 1 RP:PDB:REP 317->491|3c8wB|1e-23|13.7|168/243| HM:PFM:NREP 1 HM:PFM:REP 298->411|PF00795|3.4e-11|25.0|92/184|CN_hydrolase| RP:SCP:NREP 1 RP:SCP:REP 227->461|1erzA|1e-18|13.1|221/303|d.160.1.2| HM:SCP:REP 219->461|1f89A_|4.3e-21|22.2|221/281|d.160.1.1|1/1|Carbon-nitrogen hydrolase| OP:NHOMO 509 OP:NHOMOORG 494 OP:PATTERN -------------------------------------------------------------------- 111--------------------------------------------------------------------------------11111-----------11--1-11--111111111111111111111111111----------11--11-----------11-1--1----------------111-1-----------------------------------------------------------------------------------------------------------------------------------------------------------1---------------1-----------1-111111111111111111111111111111111-1111111111111111111111111111131-11111111111111111111111---1111111--1111111111111----1111111----111111111111111111111111111211111--111-11-111111111111111111111111121311111111111212111211----1111-------------------------111111211111111111111111111111111-11111------11111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111----------------1122111111-111112---------------------------1111111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 270 STR:RPRED 52.5 SQ:SECSTR ##########################################################################################################################################################################################################################cTTcTGGccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcTTEEEEEccTTTTTGGccccccHHHHHHHHHHHHHTcEEEEEEEEccccTTccEEEEEEEEEEEEccHHHHHHccHccTTEEcccEEEEEEEEEETTTEEEEEEEEEEEEEETTEEEE###EEEEEEccHHHHHHHHHTTEEETTEEEEEEEETTEEEEEEETTcEEccHHHHHHHHTccEEEEEEEEEEcTTccEEEEEEEEEccEEEEEEEEccEEcccTTccGGG####################### DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEccHHHcccHHccHHHHHHHHHHHHHcccEEEEEEEEEcccccccEEEEEEEEEcccccEEEEEccEEEcccccccccHHHHHHHcccccccccccccccccccEEEEccccccEEEEEEEHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEcccccEEEEcccccccEEcccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //