[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : lpxA
DDBJ      :lpxA         acyl-[acyl carrier protein]--UDP-N- acetylglucosamine O-acyltransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  554/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
b.81.1
:260 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->218 2jf2A PDBj 6e-54 45.6 %
:RPS:PDB   2->255 2aq9A PDBj 2e-18 40.7 %
:RPS:SCOP  2->257 1j2zA  b.81.1.1 * 6e-31 35.4 %
:HMM:SCOP  1->256 2jf2A1 b.81.1.1 * 6.1e-68 36.7 %
:HMM:PFM   17->34 PF00132 * Hexapep 1.7e-05 50.0 18/18  
:HMM:PFM   29->44 PF00132 * Hexapep 0.00022 43.8 16/18  
:HMM:PFM   47->64 PF00132 * Hexapep 0.00066 33.3 18/18  
:HMM:PFM   189->249 PF03246 * Pneumo_ncap 0.00084 23.3 60/391  
:BLT:SWISS 2->255 LPXA_RICFE 2e-56 43.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21730.1 GT:GENE lpxA GT:PRODUCT acyl-[acyl carrier protein]--UDP-N- acetylglucosamine O-acyltransferase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 882260..883042 GB:FROM 882260 GB:TO 883042 GB:DIRECTION + GB:GENE lpxA GB:PRODUCT acyl-[acyl carrier protein]--UDP-N- acetylglucosamine O-acyltransferase GB:PROTEIN_ID AAZ21730.1 GB:DB_XREF GI:71062727 GB:GENE:GENE lpxA LENGTH 260 SQ:AASEQ MIHKTAIIDPKAKISANVSIGAYALIGPNVEIGENSIIQSHVSIVGHTKIGTNNKIYSFASIGNDPQDLKFAGEETKLEIGDNNKIREYVTINPGTAGGGGITKVGNNCLFMVSSHIAHDCLVEDNVILANNVPLGGHAHIESNVIIGGNSAVQQFTRVGRSAMIGGMCGVVRDVIPYGIAHGNRSVLQGLNLIGLRRKNIPNKKILNLSDAYKEIFKDENLTQNLIKLDQDFKKNELVLEVVNFLEKDKKRPICTPFSK GT:EXON 1|1-260:0| BL:SWS:NREP 1 BL:SWS:REP 2->255|LPXA_RICFE|2e-56|43.3|254/264| SEG 90->108|vtinpgtaggggitkvgnn| BL:PDB:NREP 1 BL:PDB:REP 2->218|2jf2A|6e-54|45.6|217/264| RP:PDB:NREP 1 RP:PDB:REP 2->255|2aq9A|2e-18|40.7|253/262| HM:PFM:NREP 4 HM:PFM:REP 17->34|PF00132|1.7e-05|50.0|18/18|Hexapep| HM:PFM:REP 29->44|PF00132|0.00022|43.8|16/18|Hexapep| HM:PFM:REP 47->64|PF00132|0.00066|33.3|18/18|Hexapep| HM:PFM:REP 189->249|PF03246|0.00084|23.3|60/391|Pneumo_ncap| RP:SCP:NREP 1 RP:SCP:REP 2->257|1j2zA|6e-31|35.4|254/259|b.81.1.1| HM:SCP:REP 1->256|2jf2A1|6.1e-68|36.7|256/0|b.81.1.1|1/1|Trimeric LpxA-like enzymes| OP:NHOMO 608 OP:NHOMOORG 567 OP:PATTERN -------------------------------------------------------------------- 112-----------------------------------11-----1-------------------------------------121212222-2111--111111111-111111111111111111111111111----------1112111112211111111211111111111111111-----211---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------11111111111111--1111111111111111111111-1111111111111111111111111111111111111111111111111111111------------1111111111111----1-----11111111111111111111111111111111111111111111111111111111111111111--111111111111--1111111112212111111-11111111111111111111112111111111111111111111111111111111111--12111------11111111111111111-111111111111111111111111111111111111111111121111111112111111111111111111112222211111-11111111-111111111111111111111111111111111222222212111111111111111111111111112221111111122----------------------------------------------221 ------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------11---------1111-11--1112- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 257 STR:RPRED 98.8 SQ:SECSTR HEcTTcEEcTTcEEcTTcEEcTTcEEcTTEEEcTTcEEccccEEccEEEEccccEEcTTcEEEEccccTTccccccEEEEccccEEcTTcEEEcccTTTTcEEEEccccEEcTTcEEcTTcEEccccEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcEEccccEEcccccTTEEEETcTTEEEEEcHHHHHHTTccHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHTTcGGGHHHHHHHHTHcccccccc### DISOP:02AL 258-260| PSIPRED ccccEEEEccccEEcccEEEcccEEEccccEEccccEEcccEEEEccEEEccccEEcccEEEcccccccccccccccEEEEcccEEcccEEEccccccccccEEEccccEEcccEEEEcccEEccccEEccccEEccccEEccccEEccccEEEccEEEccccEEccccEEEcccccccEEEccccEEEEEccEEEEEccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccc //