[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : lpxC
DDBJ      :lpxC         UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (UDP-3-O-acyl-GlcNAc deacetylase)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  553/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
d.14.1
:306 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->285 2vesC PDBj 4e-48 39.6 %
:RPS:PDB   17->121 2c5mB PDBj 5e-09 14.9 %
:RPS:SCOP  6->121 1p42A1  d.14.1.7 * 1e-35 33.3 %
:RPS:SCOP  140->280 1p42A2  d.14.1.7 * 2e-34 34.3 %
:HMM:SCOP  4->128 1p42A1 d.14.1.7 * 3e-36 50.0 %
:HMM:SCOP  136->279 2go3A2 d.14.1.7 * 1.2e-40 39.3 %
:RPS:PFM   6->280 PF03331 * LpxC 1e-54 42.1 %
:HMM:PFM   4->279 PF03331 * LpxC 2.1e-93 41.6 274/277  
:BLT:SWISS 6->288 LPXC_GEOSM 2e-55 40.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20843.1 GT:GENE lpxC GT:PRODUCT UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (UDP-3-O-acyl-GlcNAc deacetylase) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(20458..21378) GB:FROM 20458 GB:TO 21378 GB:DIRECTION - GB:GENE lpxC GB:PRODUCT UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (UDP-3-O-acyl-GlcNAc deacetylase) GB:PROTEIN_ID AAZ20843.1 GB:DB_XREF GI:71061840 GB:GENE:GENE lpxC LENGTH 306 SQ:AASEQ MSVLNQKTINRDIIFKGVGLHSGANVTMTVKPAKPNSGILFKRVDLKENNIVVPNIFNVSSAVFCTTIANESGVSISTIEHLMGALYGLGIDNVLVEIDNQEVPILDGSAKIFIEEISKAGIKSSEAPIKIIKIEKRIEFNDGKKTISIEPSKVSLDIDFELKYENNLIGTQRNLVSVFESDLTDIYNSRTFCLFEDIAKLKEMGLAQGGSLENAIVVKDNEILNEKGLRNKKEFVNHKILDCMGDLYLAGYKIIGKIICSQGGHKLTNQLLRKVFQQDENFSLIEITEKHLPNTFINKSHLRSIA GT:EXON 1|1-306:0| BL:SWS:NREP 1 BL:SWS:REP 6->288|LPXC_GEOSM|2e-55|40.9|281/305| SEG 122->139|iksseapikiikiekrie| BL:PDB:NREP 1 BL:PDB:REP 3->285|2vesC|4e-48|39.6|280/299| RP:PDB:NREP 1 RP:PDB:REP 17->121|2c5mB|5e-09|14.9|94/235| RP:PFM:NREP 1 RP:PFM:REP 6->280|PF03331|1e-54|42.1|273/276|LpxC| HM:PFM:NREP 1 HM:PFM:REP 4->279|PF03331|2.1e-93|41.6|274/277|LpxC| GO:PFM:NREP 2 GO:PFM GO:0008759|"GO:UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase activity"|PF03331|IPR004463| GO:PFM GO:0009245|"GO:lipid A biosynthetic process"|PF03331|IPR004463| RP:SCP:NREP 2 RP:SCP:REP 6->121|1p42A1|1e-35|33.3|111/120|d.14.1.7| RP:SCP:REP 140->280|1p42A2|2e-34|34.3|137/147|d.14.1.7| HM:SCP:REP 4->128|1p42A1|3e-36|50.0|120/120|d.14.1.7|1/1|Ribosomal protein S5 domain 2-like| HM:SCP:REP 136->279|2go3A2|1.2e-40|39.3|140/0|d.14.1.7|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 598 OP:NHOMOORG 568 OP:PATTERN -------------------------------------------------------------------- 111--------------------------------------------------------------------------------11111111111111--111111111-111111111111111111111111111----------1111111111111111111111111111111111111-----111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------11111111111111--1111111111111111111111-1121111211111111111111111111111111111111111111111111111------------1111111111111----1-----11111122221222221111222222211111111121111111111111111111111111111---11111111111--1111112111121111111-11111111111111111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111211111111111111111111111111111111111111111111111----------------------------------------------111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--171-1--1111-21--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 283 STR:RPRED 92.5 SQ:SECSTR ##ccEEEEEcccEEEEcEEEEccccccTcccccEEEHHHHHHHHHHHHHHTcEccGGcccccccTTTHHHHHTEEHHHHHTTTTccccccccEEEEEcccccccTTcccccHHHHHHHTHHEEEEEEEccEEEEcccEEEEETTEEEEEEccEEEEEcccccTTTTTcTcccEEEEEccHHHHHHTTTcccEEEHHHHHHHHTTTccTTccGGGcEEEcccccccTTccccTTHHHHHHHHHHHHHHGGGccEEEEEEEEEcccHHHHHHHHHHHHHcGGGEEEE##################### DISOP:02AL 1-4, 304-306| PSIPRED cccccccccccEEEEEEEEEEccEEEEEEEEEcccccEEEEEEEEcccccEEEccHHHHcccHHEEEEccccccEEEEHHHHHHHHHHccccEEEEEEccccccEEcccHHHHHHHHHHcccccccccccEEEEEEEEEEEEccEEEEEEcccEEEEEEEEEEccccccccEEEEEEccHHHHHHHHccccHHHHHHHHHHHHccccccccccEEEEEcccEEEcccccccccccccHHHHHHHHHHHHHcccEEEEEEEEEccHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHccccc //