[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : lpxK
DDBJ      :lpxK         tetraacyldisaccharide 4'-kinase
Swiss-Prot:LPXK_PELUB   RecName: Full=Tetraacyldisaccharide 4'-kinase;         EC=2.7.1.130;AltName: Full=Lipid A 4'-kinase;

Homologs  Archaea  0/68 : Bacteria  261/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:314 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   66->314 1ddqC PDBj 9e-04 6.7 %
:RPS:PFM   18->299 PF02606 * LpxK 4e-32 33.8 %
:HMM:PFM   18->309 PF02606 * LpxK 3.8e-60 32.2 286/326  
:BLT:SWISS 1->314 LPXK_PELUB 0.0 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20972.1 GT:GENE lpxK GT:PRODUCT tetraacyldisaccharide 4'-kinase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 153756..154700 GB:FROM 153756 GB:TO 154700 GB:DIRECTION + GB:GENE lpxK GB:PRODUCT tetraacyldisaccharide 4'-kinase GB:PROTEIN_ID AAZ20972.1 GB:DB_XREF GI:71061969 GB:GENE:GENE lpxK LENGTH 314 SQ:AASEQ MKLKKPKFWDHKKPSFFSYLLLPFSIILGLITKIKSKPKFSNSKIKTICVGNIYIGGTGKTSLAIKIKEILDKNNIRACFIKKFYPNQTDEQKLLSKNGVLFSNLKRITALNEAISEGFEVAIFDDGLQDSTIKYDLEIVCFNNLNWIGNGLTLPSGPLRENINNLKSYENVFLNGNEESLIAIKEQIKRINPNININSGKYIPLNIDEFDKDQNYLVFSGIGNHKTFVEMLKNNKLKIVSDLEYPDHYQYSKKDFDEIIINAKKFNAHIITTEKDYLRLENLNKNEIFYVKSSLDISDEKNLTNKLIKLNEKN GT:EXON 1|1-314:0| SW:ID LPXK_PELUB SW:DE RecName: Full=Tetraacyldisaccharide 4'-kinase; EC=2.7.1.130;AltName: Full=Lipid A 4'-kinase; SW:GN Name=lpxK; OrderedLocusNames=SAR11_0149; SW:KW ATP-binding; Complete proteome; Kinase; Lipid A biosynthesis;Lipid synthesis; Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->314|LPXK_PELUB|0.0|100.0|314/314| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0009245|"GO:lipid A biosynthetic process"|Lipid A biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| TM:NTM 1 TM:REGION 16->33| RP:PDB:NREP 1 RP:PDB:REP 66->314|1ddqC|9e-04|6.7|239/1112| RP:PFM:NREP 1 RP:PFM:REP 18->299|PF02606|4e-32|33.8|275/322|LpxK| HM:PFM:NREP 1 HM:PFM:REP 18->309|PF02606|3.8e-60|32.2|286/326|LpxK| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF02606|IPR003758| GO:PFM GO:0009029|"GO:tetraacyldisaccharide 4'-kinase activity"|PF02606|IPR003758| GO:PFM GO:0009245|"GO:lipid A biosynthetic process"|PF02606|IPR003758| OP:NHOMO 263 OP:NHOMOORG 263 OP:PATTERN -------------------------------------------------------------------- --1---------------------------------------------------------------------------------1--1-------------111-----1-------11111111111111--11-------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------11--11---11111--111--11-1-111111111111-11-1--1-1--1111-11111111--11-111----11111111111---1-1-1------------1111111111111----1-------------------------------------------------------11-11--1--11111-----11-1-------------------1--------1----------------------------11-11111111-11-11111111111111---1111------1111-11-11---1-1--1---1---1-1--------1-111111-1------1-------1-------111111111111111111-----1111111-1111111111111111-----------111-1--11111111111111111111111111111111111-1------------11--111111----------------------------------------------1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 239 STR:RPRED 76.1 SQ:SECSTR #################################################################ccccccccTTGGGGcTHHHHHHccccccTTcccGGGTTHHHHHcccccccTTccccEEccccccEEccccccTTHHHHTTccccc##########cEEcccccEEccccccccccccccccccccccccccTTcccccccccccccccccccccTTTTcccEEEccccTTccccEEEcccccccccEEcccccccHHHHHHHHccccccccccccccccccTTTcTTTTTcccHHHHHHHHHHHccTTc DISOP:02AL 1-2, 313-314| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccEEEcccccHHHHHHHHHHHHHcccEEEEEEccccccccHHHHEEcccEEEEEcHHHHHHHHHHHccccEEEEEccccccHHHccEEEEEEcccccccccEEcccccccccHHHHccccEEEEEccccccccHHHHHHHcccccccccccEEEcccHHHcccccEEEEEEEcccHHHHHHHHHHcccEEEcccccccccccHHHHHHHHHHHHHcccEEEEEccHHHHccccccccEEEEEEEEEEcHHHHHHHHHHHHHHcc //