[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : manB
DDBJ      :manB         phosphomannomutase
Swiss-Prot:             

Homologs  Archaea  59/68 : Bacteria  599/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.84.1d.129.2
:484 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->464 1k2yX PDBj 5e-56 33.5 %
:RPS:PDB   8->471 3bkqX PDBj 3e-63 28.7 %
:RPS:SCOP  7->156 1k2yX1  c.84.1.1 * 2e-24 27.4 %
:RPS:SCOP  179->238 1k2yX2  c.84.1.1 * 4e-14 45.0 %
:RPS:SCOP  262->373 1k2yX3  c.84.1.1 * 1e-20 32.1 %
:RPS:SCOP  374->473 1k2yX4  d.129.2.1 * 9e-10 26.4 %
:HMM:SCOP  7->182 1kfiA1 c.84.1.1 * 3.6e-31 24.4 %
:HMM:SCOP  151->260 1kfiA2 c.84.1.1 * 7.3e-29 37.3 %
:HMM:SCOP  262->373 1k2yX3 c.84.1.1 * 1.8e-22 31.2 %
:HMM:SCOP  374->473 1k2yX4 d.129.2.1 * 1.1e-14 26.4 %
:RPS:PFM   37->139 PF02878 * PGM_PMM_I 6e-15 38.8 %
:RPS:PFM   184->238 PF02879 * PGM_PMM_II 2e-07 44.4 %
:HMM:PFM   12->145 PF02878 * PGM_PMM_I 5.6e-31 32.6 132/138  
:HMM:PFM   263->377 PF02880 * PGM_PMM_III 4.2e-28 29.1 110/111  
:HMM:PFM   165->258 PF02879 * PGM_PMM_II 1.8e-26 40.9 93/105  
:HMM:PFM   409->470 PF00408 * PGM_PMM_IV 7.2e-10 23.7 59/73  
:BLT:SWISS 12->461 ALGC_PSESM 1e-56 34.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21963.1 GT:GENE manB GT:PRODUCT phosphomannomutase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1115724..1117178 GB:FROM 1115724 GB:TO 1117178 GB:DIRECTION + GB:GENE manB GB:PRODUCT phosphomannomutase GB:PROTEIN_ID AAZ21963.1 GB:DB_XREF GI:71062960 GB:GENE:GENE manB LENGTH 484 SQ:AASEQ MTTNLKIDPYGFREYDARWLYEKDINQLGIENLGRGLGTQIIKHTKKTNPRVIVGHDYRSYSEEIKSALKKGLLSTGCNVEDIGLSLSPTVYFAQFNLDADAVAMVTASHNENGWTGVKMGIKKGLTHAPEEMKELKEITLNENFIKGEGNEKHIDGFQQIYKNDLINKNKITKKIKAVVACGNGTAGIFAPEILRGIGCEVIELDCDLDWTFPKYNPNPEDLEMLHAIAKAVKDNNADIGFGFDGDGDRVGVIDNTGDEIFSDKIGLLIARNLSKTHKNSKFIVDVKSTGLYATDKVLSDNNCETIYWKTGHSHIKRKVNTEKALAGFEKSGHFFFNQPLGFGYDDGINSAIHVCHLLDNQNKSMNEIIKELPNTFQTPTMAPFCKDEEKYQVVEDLVKQVNAIKDNKTKIDDQEISEVLTVNGIRFSFKDGSWGLIRASSNKPSLVIVTESPTSDERKKKIFDFIDDLLQKTGKVGEYDQKI GT:EXON 1|1-484:0| BL:SWS:NREP 1 BL:SWS:REP 12->461|ALGC_PSESM|1e-56|34.0|430/465| SEG 163->177|kndlinknkitkkik| SEG 239->255|digfgfdgdgdrvgvid| BL:PDB:NREP 1 BL:PDB:REP 12->464|1k2yX|5e-56|33.5|433/459| RP:PDB:NREP 1 RP:PDB:REP 8->471|3bkqX|3e-63|28.7|443/457| RP:PFM:NREP 2 RP:PFM:REP 37->139|PF02878|6e-15|38.8|103/137|PGM_PMM_I| RP:PFM:REP 184->238|PF02879|2e-07|44.4|54/103|PGM_PMM_II| HM:PFM:NREP 4 HM:PFM:REP 12->145|PF02878|5.6e-31|32.6|132/138|PGM_PMM_I| HM:PFM:REP 263->377|PF02880|4.2e-28|29.1|110/111|PGM_PMM_III| HM:PFM:REP 165->258|PF02879|1.8e-26|40.9|93/105|PGM_PMM_II| HM:PFM:REP 409->470|PF00408|7.2e-10|23.7|59/73|PGM_PMM_IV| GO:PFM:NREP 4 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02878|IPR005844| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF02878|IPR005844| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02879|IPR005845| GO:PFM GO:0016868|"GO:intramolecular transferase activity, phosphotransferases"|PF02879|IPR005845| RP:SCP:NREP 4 RP:SCP:REP 7->156|1k2yX1|2e-24|27.4|146/150|c.84.1.1| RP:SCP:REP 179->238|1k2yX2|4e-14|45.0|60/104|c.84.1.1| RP:SCP:REP 262->373|1k2yX3|1e-20|32.1|109/109|c.84.1.1| RP:SCP:REP 374->473|1k2yX4|9e-10|26.4|87/96|d.129.2.1| HM:SCP:REP 7->182|1kfiA1|3.6e-31|24.4|176/203|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 151->260|1kfiA2|7.3e-29|37.3|110/118|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 262->373|1k2yX3|1.8e-22|31.2|109/109|c.84.1.1|1/1|Phosphoglucomutase, first 3 domains| HM:SCP:REP 374->473|1k2yX4|1.1e-14|26.4|87/96|d.129.2.1|1/1|Phosphoglucomutase, C-terminal domain| OP:NHOMO 844 OP:NHOMOORG 663 OP:PATTERN 11111111111111111111-1113-----112222221111113131-233222223333-111-11 -11111111112111-111-11111111111111111111-111--1-----112-1122111-121-1-1-----------11----11111------11111--11-1-------111-----1111-11-11-2222211111-1--11------------------------------------11--111111111111111111111111112221---1222211--1111111111111111111111---11-----11----111----11111--111-----------11-1111111111----------111-111111111111---1----21--1--11--1213211122211--11-12211---11122221112122--1---11111-1111112-111-1-----1----111111--11111-111111111111111111------------111111111111111-1121111122211111111111111111111111211121111111111111111111111-2212222222111111211211-2111221121311112-111111212211122222222222222211222--1-21221-1------------------------111----1111111-2-1222112111-2112121221211221222-2111---1111111111211112111-11-11-122222222212--111111111111221-1111-1------11-333333312212111111111211211111--------3----11111--1--222222222222221111--1111------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1--------------1--1--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 473 STR:RPRED 97.7 SQ:SECSTR EcTTccccGGGcccccEEEEcTTTccHHHHHHHHHHHHHHHHHTTHTcccEEEEEEcccTTHHHHHHHHHHHHHTcTcEEEEEEEccHHHHHHHHHHccccEEEEEEccTccTTEEEEEEEETTEcEccTHHHHHHHHHHHHTcccccccEEEEcccHHHcHHHHHHHHcccccccEEEEEcTTcGGGGTHHHHHHHTTcEEEEEcccccTTcccccccTTcGGGcHHHHHHHHHTTccEEEEEcTTcccEEEEETTccEEcHHHHHHHHHHHHHHHcTTcEEEEETTccTTHHHHHHHHHTTcEEEEEcccHHHHHHHHHHHcccEEEcTTccEEEcTTTccccccHHHHHHHHHHHHHHccccHHHHHHTTcccEEcccEEEEccTTTHHHHHHHHHHHHHHHHTcTHHHccccccEEEccccEEEEETTEcEEEEEEcccccEEEEEEEEccHHHHHHHHHHHHHHHcTH########### DISOP:02AL 1-3, 482-484| PSIPRED cccccEEccEEEccccEEEEccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHccccEEEEEEEcccccccEEEEEEccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHHHHHccccEEEEEcccccEEEEEccccEEEcHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHcccEEEEcccHHHHHHHHHHcccEEEEEccccEEEEcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccEEEEEEEcccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHcccccccc //