[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : mdh
DDBJ      :mdh          Malate dehydrogenase
Swiss-Prot:MDH_PELUB    RecName: Full=Malate dehydrogenase;         EC=1.1.1.37;

Homologs  Archaea  53/68 : Bacteria  682/915 : Eukaryota  193/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.162.1
:320 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->318 3gvhA PDBj e-114 64.1 %
:RPS:PDB   4->310 2d4aD PDBj 8e-94 39.3 %
:RPS:SCOP  2->63 2g5cA2  c.2.1.6 * 7e-04 19.4 %
:RPS:SCOP  61->318 1obbA2  d.162.1.2 * 2e-46 12.3 %
:HMM:SCOP  2->143 1gv0A1 c.2.1.5 * 1.1e-50 49.3 %
:HMM:SCOP  144->315 1pzeA2 d.162.1.1 * 9.9e-52 41.3 %
:RPS:PFM   2->142 PF00056 * Ldh_1_N 4e-30 50.4 %
:RPS:PFM   147->311 PF02866 * Ldh_1_C 3e-24 39.0 %
:HMM:PFM   3->142 PF00056 * Ldh_1_N 7.4e-41 41.0 139/142  
:HMM:PFM   147->309 PF02866 * Ldh_1_C 1.9e-35 36.4 162/174  
:BLT:SWISS 1->320 MDH_PELUB 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21061.1 GT:GENE mdh GT:PRODUCT Malate dehydrogenase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(241897..242859) GB:FROM 241897 GB:TO 242859 GB:DIRECTION - GB:GENE mdh GB:PRODUCT Malate dehydrogenase GB:PROTEIN_ID AAZ21061.1 GB:DB_XREF GI:71062058 GB:GENE:GENE mdh LENGTH 320 SQ:AASEQ MKKISLIGAGQIGGTLAHLIGTKEVADEVVLFDVASGIAKGKALDIAQSSSVDGFNVKFSGTDNYEDIKDSDVIIITAGVPRKPGMSRDDLLGINLKIIKQVAEGIKKNAPNAFVICITNPLDVMVMAFQKFSGLPANKVVGMAGILDSSRFKLFLSLELNVPVKEIEAMVMGGHGDTMVPLPRFTKVSGKPLLDLVKEGKISPERLEEINQRTRDGGAEIVKYLEKGSAFYAPAASGVQMAEAYLKDEKKLLPCAVHLNGEYGVSNVYAGVPVIIGKDGVEKIEQIDLDEKEKKEFMHSIDAVKALWEAASKIDPDLSK GT:EXON 1|1-320:0| SW:ID MDH_PELUB SW:DE RecName: Full=Malate dehydrogenase; EC=1.1.1.37; SW:GN Name=mdh; OrderedLocusNames=SAR11_0240; SW:KW Complete proteome; NAD; Oxidoreductase; Tricarboxylic acid cycle. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->320|MDH_PELUB|0.0|100.0|320/320| GO:SWS:NREP 3 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006099|"GO:tricarboxylic acid cycle"|Tricarboxylic acid cycle| BL:PDB:NREP 1 BL:PDB:REP 3->318|3gvhA|e-114|64.1|315/318| RP:PDB:NREP 1 RP:PDB:REP 4->310|2d4aD|8e-94|39.3|300/308| RP:PFM:NREP 2 RP:PFM:REP 2->142|PF00056|4e-30|50.4|137/141|Ldh_1_N| RP:PFM:REP 147->311|PF02866|3e-24|39.0|164/169|Ldh_1_C| HM:PFM:NREP 2 HM:PFM:REP 3->142|PF00056|7.4e-41|41.0|139/142|Ldh_1_N| HM:PFM:REP 147->309|PF02866|1.9e-35|36.4|162/174|Ldh_1_C| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00056|IPR001236| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00056|IPR001236| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02866|IPR001236| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02866|IPR001236| RP:SCP:NREP 2 RP:SCP:REP 2->63|2g5cA2|7e-04|19.4|62/171|c.2.1.6| RP:SCP:REP 61->318|1obbA2|2e-46|12.3|243/307|d.162.1.2| HM:SCP:REP 2->143|1gv0A1|1.1e-50|49.3|142/0|c.2.1.5|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 144->315|1pzeA2|9.9e-52|41.3|172/0|d.162.1.1|1/1|LDH C-terminal domain-like| OP:NHOMO 1902 OP:NHOMOORG 928 OP:PATTERN 11-1--1111111111-111111111111111-111111111122222--1111------1111--12 121--12111113--------1----------1111-1--11-1-1--1-----111---11-3---1---12222221-2--2111122221211---11111111121--------------1111111111212221111111222-11211--------11-2112-------------1-12211-2224444444444444442222224442222223444444223222222222222213221323123325333555533222113344222111121111111111111111111111111111122211111--241111111212211111112122-1112211-22-1--111-1-1-123111-11111111111111211111111111111-111111111111111211111111121111111111111------------11211111111111111111111111111111111111-1111111111111111111-1111-2111111111111111--------111-----------------1-11-1-------11--121111111222212-111111222221-1-------11112111121--111111111111111111111111---1--2------22111211111111111-111111111111111111122211111111111111111111111111111--111111111111--1---------------111111111111111------1---------1----111-----111111111-1111111111212211-1-111111111---1111111111111111-1----1-1112-11111111111---1111-11111111 3422-12-C52-2232244432324232222222222222222222222333372333433323333633333233323333333311-23222222222222444-231237555554427638B2N4PqA-E9I4353G54B646465655F3554322452135542G24217332*33344CCTI3B51212121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 318 STR:RPRED 99.4 SQ:SECSTR ccEEEEEcccHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHHHHTccccEEEEccGGGGTTccEEEEcccccccTTccHHHcHHHHHHHHHHHHHHHHHHcTTcEEEEccccHHHHHHHHHHHHcccGGGEEEccHHHHHHHHHHHHHHHHTccGGGEEccEEccccTTcEEcGGGcEETTEETTTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHTccEEEEEEEEEEcGGGcEEEEEEEEEEEETTEEEEEccccccHHHHHHHHHHHHHHHHHHTTccHHcHHH## PSIPRED cEEEEEEcccHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHccccccEEEEcccHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHccccHHHEEEEccHHHHHHHHHHHHHHHcccHHHEEEEEEEcccccEEEEEEEEEEccEEHHHHcccccccHHHHHHHHHHHHHcHHHHHHHccccHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccEEEEEEEEEccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //