[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : met17
DDBJ      :met17        unknown CoA binding protein
Swiss-Prot:             

Homologs  Archaea  41/68 : Bacteria  351/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:145 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->133 1iulA PDBj 3e-25 36.8 %
:RPS:PDB   7->95 2csuA PDBj 8e-15 28.7 %
:RPS:SCOP  7->95 2csuA1  c.2.1.8 * 8e-16 28.7 %
:HMM:SCOP  1->135 1iukA_ c.2.1.8 * 2.3e-37 36.3 %
:HMM:PFM   13->98 PF02629 * CoA_binding 7.4e-09 25.9 85/96  
:BLT:SWISS 5->134 YCCU_ECOLI 7e-23 40.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22063.1 GT:GENE met17 GT:PRODUCT unknown CoA binding protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1198060..1198497) GB:FROM 1198060 GB:TO 1198497 GB:DIRECTION - GB:GENE met17 GB:PRODUCT unknown CoA binding protein GB:PROTEIN_ID AAZ22063.1 GB:DB_XREF GI:71063060 GB:GENE:GENE met17 LENGTH 145 SQ:AASEQ MNDKIKEILSKYKTIAMVGVSKDDKKPSTIVMKYMQKYGFKVIPVNPSAKGQKILGEEVFEKLEDINIPIDIVDVFRPSSEANKYAEESVKIGAKVLWLQLGIRSIDAKELVESNDIEYIENRCTKMEYQKLFLNINPAFPVLQS GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 5->134|YCCU_ECOLI|7e-23|40.0|130/137| BL:PDB:NREP 1 BL:PDB:REP 1->133|1iulA|3e-25|36.8|133/134| RP:PDB:NREP 1 RP:PDB:REP 7->95|2csuA|8e-15|28.7|87/420| HM:PFM:NREP 1 HM:PFM:REP 13->98|PF02629|7.4e-09|25.9|85/96|CoA_binding| RP:SCP:NREP 1 RP:SCP:REP 7->95|2csuA1|8e-16|28.7|87/129|c.2.1.8| HM:SCP:REP 1->135|1iukA_|2.3e-37|36.3|135/0|c.2.1.8|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 401 OP:NHOMOORG 398 OP:PATTERN 11----1111111111--1-1---11111111-----111111-----1-----1111111111--11 111-1---------1----------1-------111--11-11111---11-1-2-11---11-11-1--1-----------111111--------------------1----------------11---111111---11---11------1-----------------1------------11111----11111111111111111111111111111-11111111111--------------------1----------------------111111111111111111111111111111111111111111-11111------------------------1--1---11111----1111-1---1------------11111-111111----------1-11111111111-11121111111111---1111111112--------1----111-----------------------------1--11--------------111----11111----111---111---111111--11-1----------------1-1--11--111111111-1----------11111-1111111-1-1-------11111------1-1------------------------------------11111111111111111-1111111111111111111111111111111--1---11111111111111--111111111111---------------1--------------------------------------------------------------------------------------1-11-------------------------------------------1-111-1--- ----------------1---------------------------------------------------------------------------1-------------------------------------------------------------------------------------------1-------11----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 135 STR:RPRED 93.1 SQ:SECSTR cHHHHHcTTTcccEEEEETccccTTcHHHHHHHHHTTcccEEEEEccTccccEETTEEccccTTcccccccEEEEcccHHHHHHHHHHHHHHTccEEEEcTTcccHHHHHHHHHTTcEEEEcccHHHHHHHHHcc########## DISOP:02AL 1-2, 142-145| PSIPRED ccHHHHHHHHcccEEEEEEEEcccccHHHHHHHHHHHcccEEEEEEccccccEEccEEccccHHHccccccEEEEEEcHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHcccEEEEcccccEEcccccEEEccccccccc //