[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : metC
DDBJ      :metC         cystathionine beta-lyase
Swiss-Prot:             

Homologs  Archaea  46/68 : Bacteria  753/915 : Eukaryota  186/199 : Viruses  0/175   --->[See Alignment]
c.67.1
:367 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->348 2fq6B PDBj 7e-47 32.2 %
:RPS:PDB   31->348 3e6gA PDBj 4e-73 25.9 %
:RPS:SCOP  30->348 1cs1A  c.67.1.3 * 1e-43 27.4 %
:HMM:SCOP  27->364 1cs1A_ c.67.1.3 * 3.9e-91 35.3 %
:RPS:PFM   33->319 PF01053 * Cys_Met_Meta_PP 2e-42 33.6 %
:HMM:PFM   4->364 PF01053 * Cys_Met_Meta_PP 3.3e-94 33.1 354/386  
:BLT:SWISS 1->348 METC_RHIL3 7e-59 36.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21646.1 GT:GENE metC GT:PRODUCT cystathionine beta-lyase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 799422..800525 GB:FROM 799422 GB:TO 800525 GB:DIRECTION + GB:GENE metC GB:PRODUCT cystathionine beta-lyase GB:PROTEIN_ID AAZ21646.1 GB:DB_XREF GI:71062643 GB:GENE:GENE metC LENGTH 367 SQ:AASEQ MVRASTIIFKSMQDIRKMQDKSKKDPTGGHFDYGRQGTSTTHVLSQILKEMEECYHVFLTPTGFGSVFLSIFSIVRPGDEIIVADPTYSPTRILTQDFLKEFNVKSVFYDPHDLKTLEKAITKKTKLIFVENPGSNTFDFQDLGKIVSIAKRNKIFSVIDNTWGTPYFLKPIKLGFDMSIVSATKYYSGHSDVMGGSLAVNKKVFKQVDKANKITGLRLGPDDAYLITRGLRTLDVRLDKHEKSAKQVAEFLSNYKNIKLLYPHKKDSFNFRMWKKYYSGASGLMGLKIKSKNKNSVIKFVNSLKLFGYGYSWGGFESLALYQDKREQGNREYLKLAKDEHLVRLHIGLEDPKDLIDDLKKSLKYIK GT:EXON 1|1-367:0| BL:SWS:NREP 1 BL:SWS:REP 1->348|METC_RHIL3|7e-59|36.3|336/396| SEG 288->303|kiksknknsvikfvns| SEG 349->364|ledpkdliddlkkslk| BL:PDB:NREP 1 BL:PDB:REP 3->348|2fq6B|7e-47|32.2|342/392| RP:PDB:NREP 1 RP:PDB:REP 31->348|3e6gA|4e-73|25.9|316/368| RP:PFM:NREP 1 RP:PFM:REP 33->319|PF01053|2e-42|33.6|286/384|Cys_Met_Meta_PP| HM:PFM:NREP 1 HM:PFM:REP 4->364|PF01053|3.3e-94|33.1|354/386|Cys_Met_Meta_PP| GO:PFM:NREP 2 GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF01053|IPR000277| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF01053|IPR000277| RP:SCP:NREP 1 RP:SCP:REP 30->348|1cs1A|1e-43|27.4|318/384|c.67.1.3| HM:SCP:REP 27->364|1cs1A_|3.9e-91|35.3|337/0|c.67.1.3|1/1|PLP-dependent transferases| OP:NHOMO 2844 OP:NHOMOORG 985 OP:PATTERN 22-1111111111111-211111-122--22221--------1451-1-1221-111-1--2221--- 1741421233222144433-34223533333244443567133355423442445445--324-333334345554341-131-----22222211---11435442334---------------2223222431-43344---43---2--1--11222221----2-1-22222222222213111--12435555555555555556633435553453511333333752333333333333323334421-11113-1-331112-1-253323-------222122221211111111111111111222333222-241573333333231227721113241-5333-22--1-242333321317-33334-----34767443B467544444443446145544736783-555666665866433542424443345222222223222335611-----------------------11112345424643463344754444333844441453465441143333555745665323111343222222221234221123-2-241----565354423444442112231122212112111111123121113331314424335455433333534345342--3321------52332332222222222-2222222232222222223333334462222222222222222422222222-32233333333322-311111111112214333333-22212223333332312231333334251656414221--------12223222222332233232333331111113122--11--------1----------------------------11--22222-22 ----232-631-6734443342445533344244544444344444344537754343355534544324434535534554444423-46343362112322433-24431511211111111221-1362-21311211-1211111-1111-111211132231112133223234e4433454373643342225 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 348 STR:RPRED 94.8 SQ:SECSTR cccccccccccHHHHHHHHTTTTTccHTGGccccccccHHHHHHHHHHHHHHTccEEEEEccHHHHHHHHHHTTccTTcEEEEEccccHHHHHHHHHHHHHHccEEEEEcTTcHHHHHHHccTTEEEEEEEcccTTTcccccHHHHHHHHHHTTcEEEEEcccccTTTccGGGGTccEEEEETTTTTTcccccccEEEEEcHHHHHHHHHHHHHHcccccHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHTcTTEEEEcTTcTTcTTHHHHHHHccccccEEEEEEETTHHHHHHHHHHHccccEEcccccccccEEEcTTTTTTccTTTTTccccccEEEEEcc################### DISOP:02AL 367-368| PSIPRED cEEEEEcccccHHHHHHHHHcccccccccccEEccccccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHHcccEEEEEccccccccccHHHHcccEEEEcccccccccccccEEEEEEcHHHHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccEEccccccccccHHHHHHHccccccEEEEEEEcccHHHHHHHHHcccEEEEEcccccccEEEEccccccccHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHHHHc //