[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : miaB
DDBJ      :miaB         tRNA-i(6)A37 modification enzyme
Swiss-Prot:MIAB_PELUB   RecName: Full=(Dimethylallyl)adenosine tRNA methylthiotransferase miaB;         EC=2.-.-.-;AltName: Full=tRNA-i(6)A37 methylthiotransferase;

Homologs  Archaea  67/68 : Bacteria  791/915 : Eukaryota  106/199 : Viruses  0/175   --->[See Alignment]
b.40.4c.1.28c.92.1
:446 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   164->341 2qgqC PDBj 7e-17 30.1 %
:RPS:PDB   92->362 3cqiA PDBj 3e-38 10.5 %
:RPS:SCOP  140->365 1qgoA  c.92.1.2 * 4e-33 10.6 %
:RPS:SCOP  372->439 1yezA1  b.40.4.12 * 2e-06 15.6 %
:HMM:SCOP  96->370 1oltA_ c.1.28.2 * 3.1e-52 26.9 %
:RPS:PFM   5->101 PF00919 * UPF0004 1e-17 42.6 %
:RPS:PFM   152->322 PF04055 * Radical_SAM 1e-09 32.3 %
:HMM:PFM   4->103 PF00919 * UPF0004 8.1e-32 39.8 98/98  
:HMM:PFM   153->325 PF04055 * Radical_SAM 6.9e-31 30.8 159/166  
:HMM:PFM   378->437 PF01938 * TRAM 7.4e-12 32.2 59/61  
:HMM:PFM   322->391 PF00836 * Stathmin 6e-06 29.0 69/140  
:BLT:SWISS 1->446 MIAB_PELUB 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21204.1 GT:GENE miaB GT:PRODUCT tRNA-i(6)A37 modification enzyme GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 373181..374521 GB:FROM 373181 GB:TO 374521 GB:DIRECTION + GB:GENE miaB GB:PRODUCT tRNA-i(6)A37 modification enzyme GB:NOTE MiaB GB:PROTEIN_ID AAZ21204.1 GB:DB_XREF GI:71062201 GB:GENE:GENE miaB LENGTH 446 SQ:AASEQ MLKKIFIKTFGCQMNEYDSNRIFDTVKKIGFEKTEKYEDANCYLLNTCHIRDKAKEKVYHEIGRVKKIFREKKKPIVVVAGCVAQAENQEMLKREPYIDIVIGPQSYHKINEAILNHLKNKKKEEETEFDTISKFNYLSQIKNKDSKVSSFLTIQEGCDKFCHFCVVPYTRGPEYSRPFDQIINEAKELVQSGAKEIILLGQNVNAYSYDEEGKKYRLSDLLIKLDSFDKLERIRYTTSHPKDMTDDLINVYKTSSKLMPLVHLPVQSGSNKILNLMNRKHTIEEYLLVYEKLRKINPKIEFSSDFIIGYPEEDEQDFKMTMELIEKVKFINSYSFIFSPRPGTVAANLTLVDQKKSKQRLEIIQEKLFNNQIKKNKSLENKILNVLVENKMKDGIKLFGRTEYMTSVIFDGNIENIGKLVQVEIISSNQNSLFGKLTESSKKKVA GT:EXON 1|1-446:0| SW:ID MIAB_PELUB SW:DE RecName: Full=(Dimethylallyl)adenosine tRNA methylthiotransferase miaB; EC=2.-.-.-;AltName: Full=tRNA-i(6)A37 methylthiotransferase; SW:GN Name=miaB; OrderedLocusNames=SAR11_0383; SW:KW 4Fe-4S; Complete proteome; Cytoplasm; Iron; Iron-sulfur;Metal-binding; S-adenosyl-L-methionine; Transferase; tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->446|MIAB_PELUB|0.0|100.0|446/446| GO:SWS:NREP 6 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| SEG 119->128|knkkkeeete| BL:PDB:NREP 1 BL:PDB:REP 164->341|2qgqC|7e-17|30.1|173/263| RP:PDB:NREP 1 RP:PDB:REP 92->362|3cqiA|3e-38|10.5|266/277| RP:PFM:NREP 2 RP:PFM:REP 5->101|PF00919|1e-17|42.6|94/97|UPF0004| RP:PFM:REP 152->322|PF04055|1e-09|32.3|158/164|Radical_SAM| HM:PFM:NREP 4 HM:PFM:REP 4->103|PF00919|8.1e-32|39.8|98/98|UPF0004| HM:PFM:REP 153->325|PF04055|6.9e-31|30.8|159/166|Radical_SAM| HM:PFM:REP 378->437|PF01938|7.4e-12|32.2|59/61|TRAM| HM:PFM:REP 322->391|PF00836|6e-06|29.0|69/140|Stathmin| GO:PFM:NREP 5 GO:PFM GO:0003824|"GO:catalytic activity"|PF00919|IPR013848| GO:PFM GO:0009451|"GO:RNA modification"|PF00919|IPR013848| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF00919|IPR013848| GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 2 RP:SCP:REP 140->365|1qgoA|4e-33|10.6|207/257|c.92.1.2| RP:SCP:REP 372->439|1yezA1|2e-06|15.6|64/68|b.40.4.12| HM:SCP:REP 96->370|1oltA_|3.1e-52|26.9|264/0|c.1.28.2|1/1|Radical SAM enzymes| OP:NHOMO 2053 OP:NHOMOORG 964 OP:PATTERN 1121311111111111111111111111-111112422212131112221111212211111111211 2331311111111111111-111121111111111111112222211211111111111122222222222111111133331333333333233322233333333313-------22222223333333333332222222222222222222222222222222222222212222212222233443222222222222222222222222222222221-------3222222222222222222221----------------------------------------------------------------------33333333333333343333333333222332333334334333333321233212223323333332233333333333323333-3333333323212222222222223333233333333332222222222222333111222222222222222222222222221333332222222222222222222222222222222222222222222222222222222222111111122222233333332333332333333333322222233333333333333333333333333322222222212112222211122221211211111121211111122222112222222222-2222222222222222222222221122222222222222222122122221-111111111111---31111122223121122222222112222222232222222222221222211112222211122121211112222211122222222222211111133333333--------32-------------------2------4334434343222 1111112-1-11111----------------------------------------------------------------------------------------111-13147222212222212322529N3-6261221521222212221242323111523212222142523334T444442223-253352223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 439 STR:RPRED 98.4 SQ:SECSTR HHcTGGGGccEEEEEEEccHHHHTTccHHHHHHHHHHHHTTHHHHHHccccTTccHHHHTcHHHHHHTccccHHHHHTTccccHHHHHHccccEEEEGGGccccccHHHHHHHHHHTGGGGcTccEEEEEccccHHHHGGGGccHHHHHHHHHHHHHHccEEEEEEEGGGGTccTTcccHHHHHHHHHHHHHHHHHHHHHTccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHTcEEEEEccccGGGccHHHHHHHHHHHccTEEEEccHHHHHcccccHHHHHHHHTTTcccEEEcEEETTEEEEEcTTcccccHHHHHHHHHHTTccccEEEcccGGGcccHHHHHHHHHHHHHHHHHTGGGccHHHHHHHHHHHTEEEETcccTTcTccccEEEccccTccHHHHHHHHHHHHHHHHccHHHHHHHHTTcEEcc####### DISOP:02AL 444-446| PSIPRED cccEEEEEEccccccHHHHHHHHHHHHHcccccccccccccEEEEEEccEEcHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHcccccEEEcccccccccccccccccccccEEEEEEEcccccccccEEEEccEEcccEEccHHHHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHHHHcccccEEEEcccccccccHHHHHHHHHcccEEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHccccEEEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEEcccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEcccccEEEEEcccccEEEEcccccccccEEEEEEEEEcccEEEEEEEcHHHHHcc //